KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42830Help
Entry
OCU_42830         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_9 NAD_binding_8 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AFC45502
UniProt: H8IQU6
Position
complement(4513959..4515395)
Genome map
AA seq 478 aa AA seqDB search
MHTIEADYLVVGAGAMAMAFIDALVAEASAAQARVVVVDRNHAPGGHWTMAYPFVRLHQP
SAFYGVNSLPLGGDAIDQVGWNRGLYELATAGEICAYYDHIMRRRLLPSGRVSYFPMSEY
LGEHRGEARFRTLAGADYTVRVARRVVDATYMRVTVPAMRPPPYRVAPGIDCVPPGDLPR
RGAHERYVIVGAGKTGIDTCLWLLGQGVDPDRLTWIMPRDSWLLDRETMQPGALFAEKIK
ASFTAQLRAINDAASVRDLFDRLEEAGLLLRIDPAIRPAMYRCATVTRLELEQLRRITDV
VRMGHLRAIEADTMVLDRGAVAVSGRELYLDCTADGAEKRPATPIFDSNRITLQSVRGCQ
QIFSAALIAHVEAAYRDDSLKNELCVPLPHPDTDIDWLRLAWADYSNQLRWLDDPDLMSW
LSTARLDLFGHLIGHLLPSASAKPRVRDRILGIAKSVFSATATKLDELMAAEAALAAR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcacaccatcgaggccgactacctggtggtcggggcgggcgccatggccatggcgttc
atcgacgcgctggtcgccgaagcctcagcggcgcaggcccgcgtcgtggtggtggaccgc
aaccacgcgcccggtgggcactggaccatggcctacccgttcgtgcggctgcaccagccc
tcggcgttctacggcgtcaactcgctgccgctgggtggcgacgccatcgaccaagtcggt
tggaaccgggggctttacgaactggccaccgccggcgagatctgcgcctactacgaccac
atcatgcgccggcggctgctgccgagcgggcgggtcagctacttcccgatgagcgaatac
ctcggcgaacaccgtggtgaagcccggttccgcacgctcgccggcgccgactacaccgtc
cgggtggcgcgccgcgtcgtcgacgccacctacatgcgggtcacggtccccgcgatgcgc
ccgccgccttatcgggtcgcgcccggcatcgactgcgtcccgcccggcgacctgccgcgg
cgcggcgcccacgagcgctacgtcatcgtcggggcgggcaagaccggcatcgacacctgc
ctgtggctactgggccagggcgtcgacccggatcggctcacctggatcatgccgcgcgat
tcctggctgctggaccgcgagaccatgcagcccggcgcgttgttcgccgagaagatcaag
gccagcttcaccgcgcaactgcgcgccatcaacgacgcggcgtcggtgcgggatctgttc
gaccgcctcgaagaggccggcctgctgctgcggatcgacccggcgatccgtcccgccatg
taccgctgcgccaccgtcacccgcctcgaactcgagcagctgcggcggattaccgacgtc
gtgaggatggggcacctgcgggccatcgaggccgacacgatggtcctcgaccggggcgcc
gtggcggtcagcggccgcgagctctatctcgactgcaccgccgacggcgccgaaaagcgg
cccgccacaccgatattcgattccaaccgcatcaccctgcagagcgtgcgcggctgccaa
cagatcttcagcgcggcgctgatcgcccacgtggaggccgcgtaccgcgacgactcgctg
aaaaacgagctttgcgtgccgctgccgcatccggacaccgacatcgactggctacggctg
gcgtgggccgattacagcaaccagctgcgctggttggacgacccggacttgatgtcgtgg
ttgtcgacggcgcgcctggacctgttcggtcacctgatcggccacctgctgccgtccgcg
tcggcgaagccccgggtccgcgaccggatactgggcatcgccaagtccgtgttttccgcc
accgccaccaagctcgacgagctgatggccgccgaggccgcgctcgccgcgcgctga

DBGET integrated database retrieval system