KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42860Help
Entry
OCU_42860         CDS       T02158                                 

Definition
(GenBank) mmsB
  KO
K00020  3-hydroxyisobutyrate dehydrogenase [EC:1.1.1.31]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia00280  Valine, leucine and isoleucine degradation
mia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    OCU_42860
Enzymes [BR:mia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.31  3-hydroxyisobutyrate dehydrogenase
     OCU_42860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_2 NAD_binding_11 F420_oxidored 2-Hacid_dh_C 3HCDH_N PDH IlvN
Motif
Other DBs
NCBI-ProteinID: AFC45505
UniProt: H8IQU9
Position
4518210..4519088
Genome map
AA seq 292 aa AA seqDB search
MTEHVTVAFLGLGHMGGPMATNLVAANHAVRGFDPVPAALSAAAAAGVAAFDTAVDAVAG
ADVVMTMLPNGELVKRCYAEILPAARPGALFIDSSTISVDDAREVHALAESRGIAQLDAP
VSGGVNGAVAGTLAFMVGGDDAALQRARPVLEPMAGKIIHCGAAGAGQAAKVCNNMVLAV
QQIAIGEAFVLAEKLGLSAQSLFDVITGATGNCWAVHTNCPVPGPVPTSPANNDFKPGFA
TALMNKDLGLAMDAVSSSGSTAPLGRHAAEIYAEFAADHGDKDFSAIIETLR
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcacgtgaccgtggctttcctggggttgggccacatgggcgggcccatggcg
acgaacctcgttgcggccaaccatgcggtgcgcggattcgacccggtgcccgcggcgctg
tccgcggccgcggcggccggcgtcgccgccttcgacaccgccgtcgacgcggtggccggt
gcggacgtggtcatgaccatgctgcccaacggcgagttggtgaagcgctgctacgcggag
attctgcccgcggcgcggcccggtgctctgttcatcgacagctccacgatctcggtcgat
gacgcccgcgaggtgcatgcgctggcggagtcgcgcggcatcgcccagctggacgcgccc
gtctcgggcggggtgaacggcgcggtcgccgggacgctggcattcatggtgggtggcgac
gacgccgccctgcaacgcgcgcggccggtgctggaacccatggcgggcaagatcattcac
tgcggcgcggccggggcgggccaggccgccaaggtgtgcaacaacatggtgctggcggtg
cagcagatcgcgatcggcgaggcgttcgtcctggccgaaaagctcggcctgtcggcgcag
tcgctgttcgacgtgatcaccggggcgaccggaaactgctgggccgtgcacaccaattgc
cctgtgccgggcccggtcccgacgtcgccggccaacaacgacttcaagccggggtttgcg
accgcgctgatgaacaaggaccttggactggcgatggatgcggtgtcctccagcggttcg
accgcccccctgggccgccacgccgccgagatctacgctgagttcgccgccgatcacggt
gacaaggacttcagcgcgatcatcgagacgctgcgttga

DBGET integrated database retrieval system