KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42870Help
Entry
OCU_42870         CDS       T02158                                 

Definition
(GenBank) transcriptional regulator, MarR family protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 GntR Fe_dep_repress DPBB_1 HTH_20 HTH_IclR HTH_1 TrmB HxlR HTH_Crp_2 HTH_23 HTH_24 PadR
Motif
Other DBs
NCBI-ProteinID: AFC45506
UniProt: H8IQV0
Position
complement(4519172..4519678)
Genome map
AA seq 168 aa AA seqDB search
MADSRPDKRDPIAAARANWERAGWGDVAPGMVAVTSVMRAHQILLARVETALRPYDLSFS
RYELLRLLAFSRSGALPITKASDRLQVHVTSVTHAIRRLEADGLVQRVPHPTDGRTTLVQ
ITDLGRSTVEDATITLNKQVFADLGMSDAESQDLASSIETLRRNAGDF
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtggccgactcacgaccggacaagcgtgatccgatcgccgcggcgcgggccaactgggag
cgcgccgggtggggtgacgtggcgccgggcatggtcgcggtgacgtcggtgatgcgtgcg
caccagatcctgctggcccgcgtggagacggcgttgcggccctacgacctcagcttctcc
cggtacgaattgctgcggctgctggcgttcagccgctccggcgcgctacccatcaccaag
gcctccgaccggctgcaggttcacgtcaccagcgtcacccacgcgatccgccggctggag
gccgacgggctggtgcagcgtgttccgcaccccaccgacgggcgcaccacgctggtccag
atcaccgacctgggccgctccacggtcgaggacgcgacgatcacgctcaacaagcaggtg
ttcgccgatctcgggatgtccgacgccgaatcgcaggacctcgcgtcgtccatcgagacg
ttgcgccgcaacgccggcgacttctga

DBGET integrated database retrieval system