KEGG   Mycobacterium intracellulare ATCC 13950: OCU_42950Help
Entry
OCU_42950         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4389 DUF3687
Motif
Other DBs
NCBI-ProteinID: AFC45514
UniProt: H8IQV8
Position
complement(4528042..4528608)
Genome map
AA seq 188 aa AA seqDB search
MRGDFDSPSRWLWLVKWCVLAVPHYPILILLYLIYPFSTVAAGVAILCTGRYPRPLFVFN
VGVLRWSWRLMNYRFPMNSTDRYPPFTLASRPDYPGDLAVDYPERLKNWAVLVKWLLAIP
QVLLCWSMEAPLQVLCVIAALALLFTGTIPRGAFDLLMGMVRWRYRVAVYVSLMRDEYPP
FRMDLGAR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaggcgatttcgactcgccctcgcgctggctctggctggtgaagtggtgcgtgctg
gccgtgccgcactacccgatactgatactgctctacctgatctatccgttctcgaccgtg
gcggccggagtggccatcctgtgcaccgggcgatatccgcggccgctgttcgtattcaac
gtcggcgtgctgcgctggtcgtggcggctgatgaactaccgcttcccgatgaacagcacc
gacaggtacccgcctttcacgctggcgtctcggcccgactaccccggcgatctcgcggtc
gactatcccgagcggctgaaaaactgggcggtgctggtgaagtggctgctggccatcccc
caggttctgctgtgctggtcgatggaggcgccgctgcaggtgctgtgtgtcatcgccgcg
ctggcgctgctgttcaccgggacgatcccacggggcgcgttcgatctgctcatgggcatg
gtccgctggcgataccgggtggcggtgtacgtgtcgttgatgcgcgacgaatacccgccg
ttccgaatggatttgggcgcacgatga

DBGET integrated database retrieval system