KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43090Help
Entry
OCU_43090         CDS       T02158                                 

Definition
(GenBank) short-chain dehydrogenase Adh_1
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase NAD_binding_10 DFP
Motif
Other DBs
NCBI-ProteinID: AFC45528
UniProt: H8IRK0
Position
complement(4541023..4541787)
Genome map
AA seq 254 aa AA seqDB search
MAYERVLITGASSGLGAALARRLAGGGAVVGLVARRRDRLAEVLADCRRTAPGSAMWVAD
LADTSALRDLAATAWDTLGGIDVLINNAAVPKRRPVTALDPDEVEEVMRVNFFAPMRLTL
ALLPRMRERGSGMIVNVSSVGGRLGIIHESAYCASKFALCGWSEAMAVDLHGTPIAVKLI
EPGPVDTEIWDHPGSEEPLYRGPKVSADEVADGILAALGTEGFEHYVPDMKPVVDAKNAD
LDAFIAGAAGLAAP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacgagcgggtgctgatcacgggcgcttcgtcgggtctgggcgcggccctggcc
cggcgtctggccggcggtggcgcagtggtcgggctggtcgcgcgccgccgggatcggctg
gccgaggtcctggccgactgccggcgtaccgccccgggatcggcgatgtgggtcgccgac
ctggccgacacctccgcgctgcgtgacctggcggcgaccgcctgggacacgctcgggggc
atcgacgtgctgatcaacaacgcggccgtcccgaagcggcgcccggtcaccgcgctggat
cccgacgaggtcgaagaggtcatgcgggtcaacttcttcgccccgatgcggctgacgctg
gccctgttgccgcggatgcgcgagcggggatcgggcatgatcgtcaacgtgtccagtgtc
ggcggccggctcgggataatccacgaaagcgcctactgtgcaagcaaattcgcgctgtgt
ggctggagcgaggcgatggccgtggacctgcacggcacacctatcgcggtgaagctgatc
gagcccggcccggtggacacggagatctgggatcacccgggcagcgaggaacccctctac
cggggtcccaaggtttccgccgacgaggtggccgacggcatcctcgccgccctgggcacc
gagggcttcgagcattacgtgccggacatgaaaccggtcgtcgacgccaagaacgccgac
ctcgacgcgttcatcgccggggcggcggggctggcggcgccatga

DBGET integrated database retrieval system