KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43150Help
Entry
OCU_43150         CDS       T02158                                 

Definition
(GenBank) 50S ribosomal protein L15
  KO
K02876  large subunit ribosomal protein L15
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia03010  Ribosome
Module
mia_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    OCU_43150
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mia03011]
    OCU_43150
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    OCU_43150
  Bacteria
    OCU_43150
  Archaea
    OCU_43150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L27A Ribosomal_L18
Motif
Other DBs
NCBI-ProteinID: AFC45534
UniProt: H8IRK6
Position
complement(4547412..4547855)
Genome map
AA seq 147 aa AA seqDB search
MTIKLHDLKPARGSKTARTRVGRGEGSKGKTAGRGTKGTKARKNVPATFEGGQMPIHMRL
PKLKGFRNRFRTEYEIVNVGDLNRLFPQGGSIGVDELVAKGAVRKNSLIKVLGDGKLTVK
VEVTAHKFSGSAREKITAAGGSATELS
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
gtgactatcaagctgcacgacctgaaacccgcccgcggctcgaagaccgcccgcacccgc
gtcggtcgcggtgaaggctccaagggcaagaccgccggccgcggtaccaagggcaccaag
gcgcgcaagaacgtgccggccaccttcgagggtggtcagatgccgatccacatgcggctg
cccaagctcaaggggttccgcaaccggttccgcaccgagtacgagatcgtcaacgtcggc
gacctcaatcggcttttcccgcaaggcggttcgatcggcgtggacgagctggtggccaag
ggcgccgttcgcaagaactcgctgatcaaggtcctcggcgacggcaagttgaccgtcaag
gtcgaggtgaccgcgcacaagttcagcggcagcgcacgcgagaagatcaccgccgccggc
ggctcggccaccgagctgtcctaa

DBGET integrated database retrieval system