KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43280Help
Entry
OCU_43280         CDS       T02158                                 

Definition
(GenBank) 30S ribosomal protein S17
  KO
K02961  small subunit ribosomal protein S17
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia03010  Ribosome
Module
mia_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    OCU_43280
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mia03011]
    OCU_43280
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    OCU_43280
  Bacteria
    OCU_43280
  Archaea
    OCU_43280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S17
Motif
Other DBs
NCBI-ProteinID: AFC45547
UniProt: H8IRL9
Position
complement(4556957..4557304)
Genome map
AA seq 115 aa AA seqDB search
MAEAKKAAPKKAAAAQAASKDKGPKHTPANPKVRGRRKMRIGYVVSDKMQKTIVVELEDR
VRHPLYGKIIRTTKKVKAHDENSAAGIGDRVSLMETRPTSATKRWRLVEILEKAK
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagccaagaaggccgcccccaagaaggccgccgcagcccaagccgcgtcgaag
gacaagggccccaagcacactcccgcgaacccgaaggtgcgtggccgccgcaagatgcgc
atcggttacgtggtgagcgacaagatgcagaagaccatcgtggtcgaactggaagaccgc
gtccgtcacccgctgtacggcaagatcatccggaccaccaagaaggtcaaggcgcacgac
gagaacagcgccgccgggatcggcgaccgcgtctcgctgatggagacgcgcccgacgtcg
gcgaccaagcgctggcggctcgtcgagattctggaaaaggcgaagtaa

DBGET integrated database retrieval system