KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43410Help
Entry
OCU_43410         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C NAD_binding_8 NAD_binding_9 ApbA Lycopene_cycl TrkA_N Pyr_redox_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AFC45560
UniProt: H8IRN2
Position
complement(4564825..4566243)
Genome map
AA seq 472 aa AA seqDB search
MLIVGAGSAGSVVAERLSADADRTVTVLETGPALDDPGLLAQTANGLQLPIGVGSPLVRR
YQTHLTDEPVRQHPLVRGATVGGSGAINGGYFCRGLPRDFDRIGLPGWGWSEVLDSFRAI
ETDLDFDGPAHGDSGPILVRRTHEMTGTTERFITAAQRAGFGWIADLNDVAAEPISGIGA
VPLNIVDGVRRGSGTAYLIPALSRPNLRLHARTRAVRLRFAGSVAVGVDAIGPDGHTVFT
ADRIVLCGGAIETAHLLMLSGIGDPDALAAAGVPVVAALPVGASFSDHAEWVLPTDWTVA
PGRPVLEVVLSTADGLEIRPYTGGFVAMTGDGTAGHADWPHIGVALMQPRARGRITLVSP
DPDVAPRIEHRYDSEPDDVADLRRGIDLAHELAGSTIGSATAVWSTSQHLCGTAPMGVDG
DPRAVVDPLCRVYGIDNLWVIDGSVLPTITSRGPHATIVMIGHRASEFVSTR
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgctgatcgtcggcgccggcagtgctggatcggttgtcgccgaacgcctttccgccgac
gcggaccgcacggtcaccgtcctcgagacgggccccgccctcgacgatccgggcctgctc
gcccagaccgccaacggtctgcagctgccgatcggcgtcggcagccccctggtccggcgc
tatcagacccacctcaccgacgaacccgtccgccagcaccccctggtgcggggggccacg
gtgggcggatcgggagccatcaacggcggctacttctgccgcggattgccccgcgacttc
gaccgcatcggcctaccgggctggggatggtccgaggtgctggacagcttccgggccatc
gagaccgacctggacttcgacggtcccgcccacggcgacagcggccccatcctggtgcgc
cgcacccacgagatgacgggaaccacggagcgtttcatcaccgccgcccagcgcgccgga
ttcggctggatcgccgacctcaacgacgttgcggctgaaccaatttcggggataggcgcc
gtcccgctcaacatcgtcgacggcgtgcgcagggggtccggcaccgcgtatctcatcccg
gcgctgagccggccgaacctgcgcctgcacgcgcggacccgggcggtgcggctgcgcttc
gccgggagcgtcgcggtgggcgtggacgcgatcgggccggacggccacaccgtgttcact
gccgaccgaatcgtgttgtgcggcggcgccattgaaacggcgcatctcctcatgctctcg
ggcatcggcgaccccgacgcgctggcggccgccggggtgccggtggtcgcggcgctgccg
gtgggggcgtcgttcagcgatcacgccgagtgggtgctgcccaccgactggacggtggcc
cccgggcgcccggtgctcgaggtggtgctgagcacggccgacggcctcgagatcaggccg
tacaccggtggattcgtggcgatgaccggcgacggcaccgccgggcacgccgattggccg
cacatcggggtggccctcatgcaaccgcgcgcgcggggccgcatcacgctggtctcgccg
gatcccgacgtggcgccgcgcatcgagcaccgctacgacagcgagcccgacgacgtcgcg
gacctgcgccggggcatcgacttggcccacgaattggccggcagcacaatcggttccgcg
acggcggtctggtccacctcgcagcatctgtgcggcaccgcgccgatgggtgtcgacggc
gacccgcgggccgtcgtcgaccccctgtgccgggtctacggcatcgacaacctgtgggtg
atcgacggctcggtcctgcccacgatcaccagccgcggtccgcacgccaccatcgtgatg
atcgggcaccgggcgtcagaattcgtttcgacccgatag

DBGET integrated database retrieval system