KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43420Help
Entry
OCU_43420         CDS       T02158                                 

Definition
(GenBank) membrane sugar transferase
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_transf_21 Glyco_trans_2_3 Glyco_transf_49 Glyco_tranf_2_5
Motif
Other DBs
NCBI-ProteinID: AFC45561
UniProt: H8IRN3
Position
complement(4566279..4567697)
Genome map
AA seq 472 aa AA seqDB search
MTSSAPRLPDGFAVQVDRRVRVLGDGSALLGGSPTRLLKLAPAAQDMLCDGRLKVRDDLS
AQLARTLLDATVAHPRPAGGPSHHDVTVVIPVRNNLSGVRRLVSSLRGLRVVVVDDGSFN
AVEPEDFVGAHCDIEVLRHHRSKGPAAARNTGLAACRTDFVAFLDSDVAPRRGWLEALLG
HFCDPTVGLVAPRIVGLSHNENVVARYEAVHSSLDLGEREAPVLPHSTVSYVPSAAIICR
CSAIREVGGFDETLQSGEDVDLCWRLIESGVRLRYEPIALVAHDHRTELRDWLARKAFYG
GSAAPLSVRHPDKTAPVVISGWALMTWTLMAFGSTLSRLASIVLAVLTGRRIARAMRSAE
TSMTDVAMIAGRGLWSAALQLASALCRHYWPLALMAATMSRHFRRVVLVAAVMDGVVDWL
RRRDAVGDDVEPIGLPTYLVLKRVDDLAYGLGLWWGVLRERNVRALKPQIRS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgacctcctcggcgccccggctgcccgacggcttcgcggtccaggtcgaccgccgcgtg
cgggtgctcggcgacggctcggcgctgctcggcggttcgccgacccggctgctgaagctg
gccccggcggcacaggacatgctctgcgacggccggctgaaggtgcgcgacgacctcagc
gcccagctcgcccgcaccctgctggacgccacggtcgcgcatcccaggcccgccggcggg
ccgtcgcaccacgacgtgaccgtggtaatcccggtgcgcaacaacctttctggcgtgcgc
cggctggtgagctcgctgcgcgggctgcgcgtcgtcgtggtcgacgacggctcgttcaac
gccgtcgagcccgaagacttcgtcggcgcgcactgcgacatcgaggtgttgcgccaccac
cgcagcaagggcccggcggcggcccgcaacaccgggctggcggcctgccggacggacttc
gtggcgttcctggattccgacgtcgcgccgcgccggggctggctggaggccctgctcggt
cacttctgcgaccccaccgtcggcctggtcgcgccgcgcatcgtcggcctgtcgcacaac
gagaacgtggtggcgcgctacgaggccgtgcactcctcgctcgacctcggtgagcgcgag
gccccggtgttgccccacagcacggtgtcgtatgtccccagcgcggccatcatctgtcgg
tgctcggccatccgggaggtcggcgggttcgacgagacgttgcagtccggcgaggacgtc
gacctgtgctggcggctgatcgagtcgggcgtccggctgcgttacgagccgatcgcgctg
gtggcccacgaccaccgcaccgaattgcgggattggctcgcgcgcaaagcattttatggc
ggctcggccgccccgctgtcggtgcgccacccggacaagacggcgccggtggtgatctcc
ggctgggcgctgatgacctggacgctgatggccttcgggtccacgctgtcgcggctggcg
tccatcgtgctggccgtcctgacggggcggcgcatcgcgcgggcgatgcgcagcgcggag
acgtcgatgaccgatgtcgccatgatcgcgggccgcggcctgtggtcggcggcgctgcag
ctggcgtcggcgctgtgccggcactactggccgctggcgctgatggccgcgaccatgtcg
cggcacttccggcgggtggtactggtcgcggccgtcatggacggggtggtcgactggctg
cgccgccgggacgccgtcggcgacgacgtcgaaccgatcgggctgccgacctatctggtg
ctcaagcgcgtcgacgacctggcgtacggtctcgggttgtggtggggtgtgctacgggag
cgcaacgtgcgcgccctgaaaccccagatccgcagttag

DBGET integrated database retrieval system