KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43470Help
Entry
OCU_43470         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFC45566
UniProt: H8IRN8
Position
complement(4571313..4571450)
Genome map
AA seq 45 aa AA seqDB search
MTQTPSLSRPDERQGPVDHETETDTQLVTETLVEEVSIDGMCGVY
NT seq 138 nt NT seq  +upstreamnt  +downstreamnt
gtgactcagaccccatcgttgtcaagacccgacgaaaggcaaggccccgtggaccacgag
accgaaactgacacccagctcgtcaccgagaccctggtcgaagaggtgtccatcgacggc
atgtgcggggtctactga

DBGET integrated database retrieval system