KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43750Help
Entry
OCU_43750         CDS       T02158                                 

Definition
(GenBank) sim14 protein
  KO
K11159  carotenoid cleavage dioxygenase
Organism
mia  Mycobacterium intracellulare ATCC 13950
Brite
KEGG Orthology (KO) [BR:mia00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99988 Secondary metabolism
    OCU_43750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RPE65
Motif
Other DBs
NCBI-ProteinID: AFC45594
UniProt: H8IRR6
Position
complement(4600760..4602262)
Genome map
AA seq 500 aa AA seqDB search
MATTTTAKPGNPYLEDFLAPVSAEVTATDLKVTGRIPEHLDGRYLRNGPNPVAEVDPAVY
HWFSGDGMVHGVALQGGQARWYRNRWVRTAHVCTALGEPAPSGLNPRAGMLSVGPNTNVL
SHAGHTLALVEGGGANYRLTDELDTEGPCDFDGTLFGGYTAHPHADPRTGELHAVSYSFT
RGRTVQYSVIDTQGRARRTVDIEVGGSPMMHDFSLTDKYVVIYDLPVTFDPVQVMPANVP
RWLSLPARLVMQSLIGRVRLPSPMATAINRNQRPTSRMPYRWDDNYPARIGVMPREGGNR
DVRWFDIEPCYVYHPLNAYSEMRDGTEVLVLDVVRYARMFDRDLRGPGDSRPTLDRWTVN
LATGTVTSERRDDRPQEFPRINETLLGGPHRYGYTIGTEGGYLSGGRSEMSTAVYKHDYA
TGSATAADLDACLLLGEMSFVPNPAPGAEDDGILMGFGYHRDRDEGQLVLLDAQTLEHVA
TVHLPQRVPMGFHGNWAPAG
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccacgacaaccgccaagcccggcaacccctacctcgaggacttcctggcgccg
gtgagcgcggaggtcaccgccaccgacctcaaggtcaccggacgcattcccgaacacctc
gacgggcgctacctgcgcaacgggcccaaccccgtcgccgaggtggaccccgccgtctac
cactggttcagcggtgacggcatggtgcacggggtggcgctgcaaggcgggcaggcccgc
tggtatcgcaaccgatgggtgcgcaccgcccacgtctgcaccgcactcggcgagccggcg
cccagcgggctgaacccgcgggccggcatgctctccgtcggccccaacaccaacgtgctc
agccacgccggccacacgctcgcgctcgtcgaggggggcggggcgaactaccgcctcacc
gacgagctggacaccgaggggccctgcgacttcgacggaaccctgttcgggggatacacc
gcccatccgcacgccgacccgcggaccggcgaattgcacgcggtgtcctactcgttcacc
cgcgggcggaccgtgcagtactcggtcatcgacacccagggccgggcgcggcgcaccgtc
gacatcgaggtgggcgggtcgccgatgatgcacgacttctcgctgaccgacaagtacgtg
gtgatctacgatctgcccgtcacgttcgaccccgttcaggtgatgccggcgaacgtgccc
cgttggctgagcctgccggcccgcctggtgatgcagtcgctcatcgggcgcgtgcggctg
cccagcccgatggcgacggcgatcaatcgcaaccagcggccgaccagccggatgccgtac
cggtgggacgacaactacccggcgcgcatcggggtgatgccccgagagggcggaaatcgg
gacgtgcgctggttcgacatcgagccctgctacgtctaccacccgcttaacgcgtactcc
gagatgcgcgacggcacagaggttttggtgctcgacgtggtgcgctacgcgcggatgttc
gaccgtgacctgcgcggtcccggcgacagccggccgacgctggaccgctggaccgtcaac
ctggccaccgggacggtgaccagcgaacgccgcgacgatcgcccccaagaattcccgcgc
atcaacgagaccttgctgggcgggccgcaccggtatggctacaccatcggcaccgagggc
ggttacctgtccggcgggcgatccgagatgtcgaccgccgtgtacaagcacgactacgcg
accggatccgccaccgctgccgatctcgatgcgtgccttttgctcggcgagatgtcgttt
gtgcccaatcccgcaccgggcgccgaggatgacggcatcctcatggggttcggctatcac
cgcgaccgcgacgagggccaactggtcttgctggacgcgcagacgctcgagcacgtcgcc
accgtgcatctgccgcagcgggtgccgatgggattccacggcaactgggcgccggctggc
taa

DBGET integrated database retrieval system