KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43870Help
Entry
OCU_43870         CDS       T02158                                 

Definition
(GenBank) methoxy mycolic acid synthase 1
  KO
K00574  cyclopropane-fatty-acyl-phospholipid synthase [EC:2.1.1.79]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Brite
KEGG Orthology (KO) [BR:mia00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OCU_43870
Enzymes [BR:mia01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.79  cyclopropane-fatty-acyl-phospholipid synthase
     OCU_43870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMAS Methyltransf_25 Methyltransf_12 Methyltransf_23 Methyltransf_11 Methyltransf_31 PCMT MetW Methyltransf_9 Methyltransf_4 MTS Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AFC45606
UniProt: H8ISG1
Position
4614197..4615069
Genome map
AA seq 290 aa AA seqDB search
MGVAMVKLEPYYEESQATYDISDDFFALFLDPNMVYTCAYFKDDDMTLEQAQLAKLDLGL
DKLNLEPGMTVLDVGCGWGGAVVRALEKYDVNVIGITLSRNHYTRTKARLAAIPTTRRAE
ARLQGWEEFDEHVDRIISFEAFDAFKKERWPAFWDWAYETLPNDSRMLMHSIFTYPQSHW
KEVGIKITMSDLRFLHFLGKEIFPGGQMCGEADIVDLSRASGFGLEQTQYLQSHYARTLD
TWAANLEANRDRAIAIQSEEVYDRFMRYLTGCANLFRKGISNVAQYTLTK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgtcgcaatggtgaagctggagccgtattacgaagagtcgcaggctacctacgac
atttcggacgacttcttcgcgttgttcctcgacccaaacatggtctacacctgcgcgtat
ttcaaagacgacgacatgaccttggaacaggcgcagctggccaagctggacctggggctg
gacaagctgaacctcgagccgggcatgacggtgctcgacgtcgggtgcggctggggcggg
gccgtggtccgggcgctggagaaatacgacgtcaatgtcatcggcatcacgctcagccgc
aaccattacacgcgcaccaaggcgcggctggccgcgatcccgacgacgcggcgcgccgag
gcccggctgcaggggtgggaagaattcgacgagcacgtcgaccggattatcagcttcgag
gccttcgacgcgttcaaaaaggaacgctggcccgcgttctgggactgggcatatgaaacc
ctccccaacgacagccggatgctgatgcacagcatcttcacctacccgcaatcgcactgg
aaggaagtcggcatcaagatcacgatgtcggacctgcgcttcctgcacttcctcggcaag
gagatctttcccggcgggcagatgtgcggcgaagccgacatcgtcgacctttcgcgagcc
agcggtttcggcctcgagcagacgcaatacctgcagtcgcactacgcccggacgctggac
acctgggcggccaacctggaggccaaccgcgaccgcgcgatcgccatccagtccgaagag
gtctacgaccgcttcatgcgctacctgacgggctgcgcgaaccttttccgcaaaggcatc
tcgaacgtggcccagtacacgctcaccaagtag

DBGET integrated database retrieval system