KEGG   Mycobacterium intracellulare ATCC 13950: OCU_43910Help
Entry
OCU_43910         CDS       T02158                                 

Definition
(GenBank) 50S ribosomal protein L1
  KO
K02863  large subunit ribosomal protein L1
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
mia03010  Ribosome
Module
mia_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:mia00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    OCU_43910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mia03011]
    OCU_43910
Ribosome [BR:mia03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    OCU_43910
  Bacteria
    OCU_43910
  Archaea
    OCU_43910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L1
Motif
Other DBs
NCBI-ProteinID: AFC45610
UniProt: H8ISG5
Position
complement(4618221..4618928)
Genome map
AA seq 235 aa AA seqDB search
MSKNSKAYRAAAEKVDRNSLYSPLEAAKLAKETSSSKQDATVEVAIRLGVDPRKADQMVR
GTVNLPHGTGKTARVAVFAVGDKAEQAQAAGADIVGSDDLIEKIQGGWLEFDAAIATPDQ
MAKVGRIARVLGPRGLMPNPKTGTVTPDVAKAVADIKGGKINFRIDKQANLHFVIGKASF
DEKSLAENYGAALDEVLRLKPSASKGRYLKKITVSTTTGPGIPVDPSVTRNFSEA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaacagcaaggcataccgcgccgccgccgagaaggtggaccgcaacagcctg
tactccccgctggaggcggccaagctcgccaaggaaacgtcgtcgagcaagcaggacgcg
accgtcgaggtggcgatccggctcggcgtcgacccgcgcaaggccgaccagatggtccgc
ggcacggtgaacctgccgcacggcaccggcaagaccgcccgggtggcggtgttcgcggtc
ggcgacaaggccgagcaggcgcaggccgccggcgcggacatcgtcggcagcgacgacctg
atcgagaagatccagggcggctggctggagttcgacgccgcgatcgcgaccccggaccag
atggccaaggtcggccgcatcgcgcgggtgctcggtccgcgcggcctgatgccgaacccg
aagaccggcaccgtcacccccgacgtcgccaaggccgtggccgacatcaagggcggcaag
atcaacttccgcatcgacaagcaggccaacctgcacttcgtcatcggcaaggcctccttc
gacgagaagtcgctggccgagaactacggcgccgcgctcgacgaggtgctgcggctcaag
ccgtccgcgtcgaagggccgctacctgaagaagatcaccgtgtcgacgacgacggggccg
ggcattccggtcgacccgtcggtcacccgcaacttctccgaggcctga

DBGET integrated database retrieval system