KEGG   Candidatus Beckwithbacteria bacterium GW2011_GWC1_49_16: UY43_C0001G1155Help
Entry
UY43_C0001G1155   CDS       T04022                                 

Definition
(GenBank) hydroxymethylglutaryl-CoA synthase
  KO
K01641  hydroxymethylglutaryl-CoA synthase [EC:2.3.3.10]
Organism
mib  Candidatus Beckwithbacteria bacterium GW2011_GWC1_49_16
Pathway
mib00072  Synthesis and degradation of ketone bodies
mib00280  Valine, leucine and isoleucine degradation
mib00650  Butanoate metabolism
mib00900  Terpenoid backbone biosynthesis
mib01100  Metabolic pathways
mib01110  Biosynthesis of secondary metabolites
mib01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mib00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    UY43_C0001G1155
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    UY43_C0001G1155
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    UY43_C0001G1155
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UY43_C0001G1155
Enzymes [BR:mib01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.10  hydroxymethylglutaryl-CoA synthase
     UY43_C0001G1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMG_CoA_synt_C ACP_syn_III_C ACP_syn_III HMG_CoA_synt_N Thiolase_N AFP_2
Motif
Other DBs
NCBI-ProteinID: AKM79868
Position
1044669..1045715
Genome map
AA seq 348 aa AA seqDB search
MLNKFKFKNVGVIGFGAHVPTYRITVDEIAKVHEKDGRAIAASLGVKEKAVADRDEDTVS
LAAAAALHSLKRVQGKLFKPKDLGAVLVGSESHPYAVKPTGSVVAEILGVGREYLTADLE
FACKAGTTAMIVIASLIEAGLIEAGLAIGADVAQSRRGDALEYTAGAGAAAVVLGSKKYP
WQAKFEAASSFNSDTPDFWRRAGQKFPAHAGRFTGEPAYFAHVEEGTRQFLKKFRQKIGW
FNHVVLHMPNGKFPKKAAARLGVTAGQLKTGFIVEKIGNPYCASAMTGLVKVLEEGRKNQ
KILMTSYGSGAGSDSISLTILQKNSIGKDTDVSEQIKKFEYISYSKLC
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgttaaataagtttaaatttaaaaacgtcggggtgatcggttttggggcgcacgtgcca
acttacaggatcacggttgacgagatagctaaggtgcacgagaaagacggccgggccatt
gccgcgtctttgggggtaaaagaaaaagcggtggccgaccgcgacgaggatacggtcagt
ttggcggcggcggcggcccttcactcgctcaagcgagttcagggtaaactttttaagccg
aaagatttgggggcggtgttggtgggcagtgagagccatccttacgcggtcaagccgacg
gggtcggtggtggccgagattttgggagtgggtagagagtatctgacggcagatttggag
tttgcctgcaaggccgggacaacggcgatgattgtgatcgcctctttaatcgaggcgggt
ttaatcgaggcggggttggcgatcggcgccgatgtggctcaaagccggcggggggacgcc
ttggagtacacggccggggcaggagcggcggcagtggtcttgggcagtaaaaaatatccc
tggcaggcaaaatttgaggcggcgagcagctttaactcggacacgccggacttttggagg
agggcagggcagaagtttccggcccacgcgggcagattcaccggcgagccggcttacttt
gctcatgtagaagagggtaccaggcagtttttgaaaaaattcaggcagaagataggctgg
tttaaccatgtggtgctgcatatgcccaacggcaagtttcccaaaaaagccgctgccagg
ttaggggtaacggctgggcagcttaaaacaggttttatcgtcgaaaagatcggcaatcct
tactgcgcttcggcgatgactgggttggtgaaagttttggaagaggggagaaaaaaccag
aagattctgatgaccagctatggctcgggggcgggctcagacagcatcagtttgacgatt
ttgcagaaaaactcgattggtaaagatactgatgtttcagagcaaataaagaagtttgag
tatattagctattcaaagctatgttaa

DBGET integrated database retrieval system