KEGG   Microcoleus sp. PCC 7113: Mic7113_0548Help
Entry
Mic7113_0548      CDS       T02374                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00051  Fructose and mannose metabolism
mic00520  Amino sugar and nucleotide sugar metabolism
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mic7113_0548
   00520 Amino sugar and nucleotide sugar metabolism
    Mic7113_0548
Enzymes [BR:mic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Mic7113_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AFZ16465
UniProt: K9W7U9
Position
complement(633624..634685)
Genome map
AA seq 353 aa AA seqDB search
MDKSLIPVILAGGKGERFWPLSRKHRPKQFLSLDGSGKSLLQATADRLSELAGSSEKLWV
VTSAQLAQGVREQLPQLLEKNVLAEPEGRDTAPAVAWSTLEIARTYGEDAVVAFFPADHW
IEDQQAFQNTIKAAAELASKEDAIVTLGITPNHPSTGYGYIEQGEQTGTFGGLPVYKVSR
FTEKPDRETAEQFLATGRFSWNSGMFIFRAGVVLNELRTYAPEIIGPLEEKGVEAYHQLP
KKSVDYALMEKTQLAYVLPASFGWDDLGDWNAIERLLKGDAANVELAQHVGMDTKGAILY
ASDNDEVIVTIGLEDIVVVRDRNVTLIVKKDRTQEIKQVVKALQEDPKLQDLL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggataaatccttgatacccgtgattctggctggtggcaaaggggagcgtttttggcct
ttgagccggaagcaccgaccgaagcagtttttaagcttagatggtagtggaaagagcctt
ttgcaggcaacggctgaccgactcagtgagttagccggaagctctgagaagctatgggtg
gtgacttccgctcaactggctcaaggggttcgagaacagctccctcagcttttagagaag
aatgtattagcggagccagaagggcgtgataccgctccagccgtggcttggtctacgctg
gagattgcacgaacctatggggaagatgctgtggtggcctttttcccggctgaccactgg
attgaagaccagcaagcgtttcaaaacactatcaaggcggcggctgaactggcgtccaag
gaagatgcgattgtgacactaggcatcacgccgaaccatccttctacaggttatgggtac
atcgagcaaggcgaacagacggggacgtttggcggattgccagtttataaagtcagtcgc
ttcactgaaaagcccgatcgcgaaacggctgagcaatttctggctacagggcgctttagc
tggaatagtgggatgttcattttccgggctggggtggtattgaatgaactccgtacttat
gcacccgaaatcatcggcccactggaagaaaaaggtgtagaggcgtatcaccagctacca
aagaaaagtgttgactatgcattgatggaaaagacccaattggcgtatgttttacccgcg
tcgtttggttgggatgatttgggagattggaacgcgatcgagcgcttactgaagggagat
gcagctaatgtggagctggcgcagcatgtggggatggataccaagggagccattctttac
gccagtgataacgatgaagtgattgtgacgattgggttagaggatattgttgtggtgcgc
gatcgcaacgtcaccttaatcgtgaaaaaagaccggacacaggagattaagcaggtcgtt
aaagcgcttcaagaagacccaaaactgcaagacttgttgtaa

DBGET integrated database retrieval system