KEGG   Microcoleus sp. PCC 7113: Mic7113_1986Help
Entry
Mic7113_1986      CDS       T02374                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00230  Purine metabolism
mic00240  Pyrimidine metabolism
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
Module
mic_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mic_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
mic_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Mic7113_1986
   00240 Pyrimidine metabolism
    Mic7113_1986
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mic04131]
    Mic7113_1986
Enzymes [BR:mic01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Mic7113_1986
Membrane trafficking [BR:mic04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Mic7113_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AFZ17835
UniProt: K9WBS0
Position
complement(2320923..2321372)
Genome map
AA seq 149 aa AA seqDB search
MERTFLMIKPDGVQRNLVGEIIRRFEAKGFTLVGLKLMSVSKELAEKHYDVHKERPFFPG
LVQFITSGPVVAMVWEGDGVIASARKIIGATNPLNAEPGTIRGDYGVTVGRNLIHGSDAP
ETAQQEIGLWFKDEELASWQPTLTPWLYE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttggaacgcacatttctcatgattaagccggatggcgtacagcgtaaccttgtgggtgaa
atcatccggcgttttgaggcaaaaggctttactctggttgggttaaagctgatgagtgtg
agcaaggaacttgcagaaaaacactatgacgttcacaaagaacgaccctttttccccgga
ctcgtccagttcatcacctctgggccggtggtggcaatggtttgggaaggcgatggtgtg
attgcctcagcgagaaagatcattggtgccaccaatcccctcaatgctgaaccgggtacg
attcgcggcgattatggcgtcacagtcggtcgtaacctcattcatggttcagatgctccg
gagacagcacagcaagagattggcttgtggtttaaggacgaggaactcgctagctggcaa
ccgaccttaacaccctggttgtacgagtaa

DBGET integrated database retrieval system