KEGG   Microcoleus sp. PCC 7113: Mic7113_2554Help
Entry
Mic7113_2554      CDS       T02374                                 

Definition
(GenBank) ferredoxin protochlorophyllide reductase subunit L
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00860  Porphyrin and chlorophyll metabolism
mic01100  Metabolic pathways
mic01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mic7113_2554
Enzymes [BR:mic01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Mic7113_2554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MipZ MeaB AAA_24 AAA_25
Motif
Other DBs
NCBI-ProteinID: AFZ18348
UniProt: K9WDN6
Position
complement(2935511..2936377)
Genome map
AA seq 288 aa AA seqDB search
MKLSVYGKGGIGKSTTSCNISVALAKRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQE
KDYHYEDVWPEDVIYKGYGGVDCVEAGGPPAGAGCGGYVVGETVKLLKELNAFDEYDVIL
FDVLGDVVCGGFAAPLNYSDYCMIVTDNGFDALFAANRIAASVREKARTHPLRLAGLIGN
RTSKRDLIDKYISSVPMPVLEILPLIEDIRVSRVKGKTLFEMAETDSSLNYVCDYYLNIA
DQILGRPEGVVPNDAPDRELFSLLSDFYLNPQQPPATTEEEKLDLMMV
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactctcagtttatggaaaaggcggcattgggaaatccacgacgagctgtaatatc
tctgttgccctagcaaagcgtggtaagaaggtactgcaaattggttgtgatccgaagcac
gacagcaccttcaccctcacaggctttttaattcctacaattatcgatacgcttcaggaa
aaggattaccactacgaagatgtttggcctgaagatgtcatctacaaaggctatggtggc
gttgattgcgtagaagcgggtggtccccctgctggtgcaggttgcggtggctatgtggtt
ggtgagacagtgaagctgctcaaagaactcaacgcttttgatgagtatgatgtgattttg
tttgacgttctcggtgacgtagtctgtggcggttttgccgcacccctcaactactccgac
tactgcatgattgtcacagataacgggtttgacgccttgtttgccgccaatagaattgct
gcctccgtgcgtgaaaaagctcgcacccaccctctgcgtctggcgggactcattggcaat
cgcacctcgaagcgcgacttgatcgacaagtatattagctcagtgccgatgccagtgctg
gagattttacctctgattgaggatattcgcgtctcccgcgttaagggcaaaaccttattt
gagatggcagagacagactcctcactcaactatgtctgtgactactatctgaacattgct
gaccaaattttgggtcgtccagagggtgttgtccccaatgatgctcccgatcgcgaattg
ttctccttattgtctgatttctacctcaatccgcagcagccaccagcaacaactgaggaa
gaaaaactcgatctgatgatggtttaa

DBGET integrated database retrieval system