KEGG   Microcoleus sp. PCC 7113: Mic7113_4495Help
Entry
Mic7113_4495      CDS       T02374                                 

Definition
(GenBank) glycerol dehydrogenase-like oxidoreductase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
mic  Microcoleus sp. PCC 7113
Pathway
mic00561  Glycerolipid metabolism
mic00640  Propanoate metabolism
mic01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mic00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Mic7113_4495
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Mic7113_4495
Enzymes [BR:mic01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     Mic7113_4495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC Arginase PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AFZ20183
UniProt: K9WJ25
Position
5265623..5266843
Genome map
AA seq 406 aa AA seqDB search
MTISQQRDDIPDQSSTDFSATGMNQAPTSLLSLSVAPAQVLRGNQALEQSVDAIARLGKR
PLVVGGDRTLASLTSKLKPVLEQQQLSYSSASYTPDCSEASLSALKEAAASHQADLIIGI
GGGKALDTAKLLAYQCQLPIVTIPTSGATCAAWTALSNIYSDEGAFLYDVSLNHCPDLLI
LDYNLIQTAPQRTLIAGIGDALAKWYEASVSSGSSPVTLIIAAVQQARVLRDILFQKSAD
ALKEPGSEAWREVVDATVLLAGVIGGLGGAQCRTVAAHAVHNGLTHLPSAHDALHGEKVA
YGILVQLRLEEMLQGNQLAASARQQLLKFYSEIGLPQTLEDLGLGNITLAELRKAAEIAC
NPNSDIHRLPFEVVPDQLMAAMVSTTTPVEKSRSPLGLTVAVTDSQ
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctcccagcaacgggatgatatacctgatcaatcctcaactgacttttctgct
acaggcatgaaccaagccccaacttcattactgtccttatcggttgcacctgctcaagtg
ttgcggggtaatcaagcactggaacaatcggtcgatgcgatcgcacgtctggggaaacgt
cccttagtcgtaggaggcgatcgcaccctagcttccctcacctcaaaactaaaaccggtt
ctagaacaacagcaactcagctattcttcagcctcctacactcctgattgctctgaagct
tctttatccgccctcaaagaagctgccgcctcccatcaagcagatttgattattgggatt
ggtggcggaaaagccttagacaccgccaaactcttagcctatcagtgccagttgccgatt
gtaaccattccgacatcaggtgccacctgtgcggcttggacggctttatccaatatctat
tccgatgaaggcgcattcctctatgatgtgtcccttaaccactgcccagacttattaatc
cttgattacaacctaattcagacagcaccacaacgcaccttaattgccgggattggtgat
gccttagccaagtggtatgaagcatctgtcagtagcggcagttcacccgttaccctaatt
attgccgctgtccaacaggccagagttttgcgtgatatcctgtttcaaaaatcagcagat
gccctgaaagaaccgggcagtgaagcttggcgggaagtggtggatgctacggttttactc
gcgggtgtgattggcggtttggggggtgcccagtgtcggactgttgccgcccatgctgtt
cacaatggcttaacccatcttccatcggcccacgatgccctacatggtgagaaagttgcc
tatgggattctggtgcagttgcgtttagaagaaatgcttcagggaaatcaattagcggca
tctgcacggcaacaactgctgaaattttacagcgaaattggtttacctcaaacgctggaa
gatttggggttaggaaacatcaccttggcagagttacggaaagcggcggaaattgcctgt
aatcctaattccgacattcatcgcctaccgtttgaagtcgtacccgatcaactcatggcg
gcgatggtttctacgacaacaccagtggagaaaagtcgcagccccctgggtttaacggta
gccgtcactgactctcaataa

DBGET integrated database retrieval system