KEGG   Micromonospora sp. B006: MicB006_1508Help
Entry
MicB006_1508      CDS       T05583                                 

Definition
(GenBank) tRNA pseudouridine synthase B
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
micb  Micromonospora sp. B006
Brite
KEGG Orthology (KO) [BR:micb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:micb03016]
    MicB006_1508
Enzymes [BR:micb01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     MicB006_1508
Transfer RNA biogenesis [BR:micb03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    MicB006_1508
 Prokaryotic type
    MicB006_1508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TruB_N TruB_C TruB_C_2 DUF2244 DKCLD
Motif
Other DBs
NCBI-ProteinID: AXO33803
UniProt: A0A385APD2
Position
1543023..1543907
Genome map
AA seq 294 aa AA seqDB search
MSTDGLIVVDKPGGMTSHDVVARIRRLARTRRVGHGGTLDPMATGVLVIGVGRATRLLTY
VIGAGKSYAATIRLGQSTVTDDAEGEVVAITPAGAVTDDGVRAALAALTGEIDQVPSAVS
AIKINGQRAYKRVRDGETVELPARRVTVSRLEVRAIRRDVPDVVDVDVDVTCSSGTYIRA
LARDAGAALGVGGHLTALRRTAVGGFTLAEAATLDQLEQRAPDVVNLPLDAAAARFFPRR
DATADETRVLSHGGPLTPAGITGPYAVFDPAGGLIAIVSERDGRARAEIVLAPA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacagacggtctgatcgtggtcgacaagcccggcggcatgacgtcgcacgacgtc
gtggcccgcatccggcggctggcgcgtacccgccgcgtcggccacggcggcacgctcgac
ccgatggccaccggcgtcctcgtgatcggggtgggccgggcgacccggctgctcacgtac
gtgatcggcgccggcaagagctatgccgcgacgatccgcctgggccagtccaccgtcacc
gacgacgccgagggcgaggtggtcgccatcaccccggccggcgcggtcaccgacgacggg
gtacgcgccgcgctggccgccctgaccggcgagatcgaccaggtgccgagcgcggtcagc
gccatcaagatcaatggtcagcgggcgtacaagcgggtccgcgacggcgagacggtcgag
ctgcccgcccgccgggtcaccgtctcccggctggaggtgcgggccatccgccgggacgtc
ccggacgtggtggatgtggacgtggacgtgacctgctcgtccgggacgtacatccgggcc
ctggcccgcgacgcgggggccgcgctgggcgtcggcggtcacctcaccgcgctgcgccgc
accgccgtcggcgggttcacgctcgccgaagcggccacgctcgaccagttggagcagcgc
gcgccggacgtggtcaacctgccgctggacgccgccgccgcgcggttcttcccgcgccgg
gacgccaccgccgacgagacccgggtgctctcccacggcgggccgctgaccccggccggg
atcaccgggccgtacgcggtcttcgacccggcgggcgggctgatcgctatcgtcagcgag
cgggacgggcgggcccgcgcggagatcgtgctggccccggcctga

DBGET integrated database retrieval system