KEGG   Micromonospora sp. B006: MicB006_2887Help
Entry
MicB006_2887      CDS       T05583                                 

Definition
(GenBank) acyl-coenzyme A oxidase 1
  KO
K00232  acyl-CoA oxidase [EC:1.3.3.6]
Organism
micb  Micromonospora sp. B006
Pathway
micb00071  Fatty acid degradation
micb00592  alpha-Linolenic acid metabolism
micb01040  Biosynthesis of unsaturated fatty acids
micb01100  Metabolic pathways
micb01110  Biosynthesis of secondary metabolites
micb01212  Fatty acid metabolism
Module
micb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:micb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MicB006_2887
   00592 alpha-Linolenic acid metabolism
    MicB006_2887
   01040 Biosynthesis of unsaturated fatty acids
    MicB006_2887
Enzymes [BR:micb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.6  acyl-CoA oxidase
     MicB006_2887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACOX Acyl-CoA_dh_M Acyl-CoA_dh_1 Acyl-CoA_dh_N
Motif
Other DBs
NCBI-ProteinID: AXO35168
UniProt: A0A385AT68
Position
3032469..3034460
Genome map
AA seq 663 aa AA seqDB search
MLDHASGRIDITRLREALDGRWAEVRRAHREHLDERFLPVYGETGDQARERITRLLSELP
VELGIASGFPAEYGGRGDVGASIVATEMLAQVDLSLMVKAGVQWGLFGGAVAALGTKRHH
DAYLRDIVAGRLFGCFAMTETGHGSDVQQLRTTCVYDPQTQTFDLHTPHEAARKDYIGNA
ARDGRMAVVFAQLVTGGRRHGVHAWLVPIRDEHGKPMPGVTIGDAGPKAGLLGVDNGRLS
FDHVRVPRDMLLDQYAQVAEDGTYSSPIENDSRRFFTMLGTLVRGRVSVGGAASAATKSA
LAIAVRYGDIRRQFADADGDREVLLNDYLAHQRKLLPALATTYALTFAQAELVAALDEIQ
GGDGPVDEHRQRELESRAAGLKAAQTWHATRTIQICREACGGAGYLSENRLPSLKADTDV
FTTFEGDNTVLLQLVAKGLLTGYRDEFGSLDGWGRASFVAEQVREMVLERTAARALIARL
VSAVPGRDDEVAVTDRGWQLKLFEDREEHLLDSAVRRLRGGASTKKDRPFDIFNDVQDHV
LAVAAAHIDRVTLEAFVAGIDAIADPAVKELLSRVCDLYALSVIEANKGWLLEHGRLTPA
RSKTITSVVNGLLKELRPDMRTLVDGFAIPDAWLHAAILREEPVRQETMAAHDAAGDPQA
VPA
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgctcgatcacgcatccggccgcatcgacatcacacgcctgcgggaagcgctcgacggc
cggtgggccgaggtccgccgggcgcaccgcgaacatctcgacgaacgcttcctcccggtg
tacggcgagaccggtgaccaggcccgcgagcgcatcacccggctcctgtccgaactcccc
gtcgagctgggcatcgcctccggtttccccgccgagtacggcggccgcggcgacgtgggc
gcctcgatcgtcgccaccgagatgctggcccaggtggacctgtcactgatggtgaaggcc
ggcgtgcagtggggcctgttcggcggcgcggtcgccgccctcggcacgaagcggcaccac
gacgcctacctgcgggacatcgtcgcgggccggctcttcggctgcttcgcgatgaccgag
accggccacggctcggacgtgcagcaactgcgcaccacctgcgtctacgacccgcagacg
cagaccttcgacctgcacaccccgcacgaggccgcgcgcaaggactacatcggcaacgcg
gcccgggacgggcggatggctgtggtgttcgcccagctcgtcaccggcgggcgccgccac
ggggtgcacgcctggctggtgccgatccgcgacgagcacggcaagccgatgcccggcgtg
accatcggcgacgccgggcccaaggccggcctgctcggcgtggacaacgggcggctcagc
ttcgaccacgtgcgggtgccgcgggacatgctgctggaccagtacgcgcaggtcgccgag
gacggcacgtactccagcccgatcgagaacgactcccggcgcttcttcaccatgctgggc
accctggtccggggccgggtgagcgtgggcggcgccgcgtcggcggccaccaagtcggcg
ctggccatcgcggtgcgctacggcgacatccgccggcagttcgccgacgccgacggcgac
cgcgaggtgctgctcaacgactacctggcgcaccagcgcaagctgctgcccgcgctggcc
accacgtacgcgctgaccttcgcccaggcggagctggtcgcggcgctcgacgagatccag
ggcggcgacgggccggttgacgagcaccggcagcgggagctggagtcccgggccgccggt
ctgaaggcggcgcagacctggcacgccacccgcaccatccagatctgccgggaggcgtgt
ggcggcgccggctacctgtccgagaaccgcctgcccagcctcaaggccgacaccgatgtc
ttcaccaccttcgagggcgacaacacggtgctgctgcaactggtcgccaaggggctgctg
accggctaccgggacgagttcggctcgctcgacggctggggacgcgcctccttcgtggcc
gagcaggtacgcgagatggtgctggaacgcaccgccgcgcgggcgctgatcgcacgtctg
gtcagcgccgtgcccgggcgcgacgacgaggtcgccgtcaccgaccggggctggcagctc
aagctcttcgaggaccgcgaggagcacctgctcgacagcgcggtccgccgcctgcgcggt
ggcgcgtccaccaagaaggaccgccccttcgacatcttcaacgacgtccaggaccacgtc
ctcgccgtcgccgccgcgcacatcgaccgggtgacgctggaggcgttcgtcgccgggatc
gacgccatcgccgacccggcggtcaaggaactgctgtcccgggtctgcgacctgtacgcg
ctcagcgtgatcgaggcgaacaagggctggctgctggagcacgggcggctcaccccggcc
cgctcgaagaccatcaccagcgtggtgaacgggctgctcaaggagctgcgcccggacatg
cgcacgctcgtggacggcttcgccatcccggacgcatggctgcacgcggcgatcctgcgc
gaggagcccgtccggcaggagacgatggccgcgcacgacgccgccggcgacccgcaggcc
gtccccgcctag

DBGET integrated database retrieval system