KEGG   Micromonospora sp. B006: MicB006_4532Help
Entry
MicB006_4532      CDS       T05583                                 

Definition
(GenBank) LSU ribosomal protein L22p (L17e)
  KO
K02890  large subunit ribosomal protein L22
Organism
micb  Micromonospora sp. B006
Pathway
micb03010  Ribosome
Brite
KEGG Orthology (KO) [BR:micb00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    MicB006_4532
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:micb03011]
    MicB006_4532
Ribosome [BR:micb03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    MicB006_4532
  Bacteria
    MicB006_4532
  Archaea
    MicB006_4532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AXO36799
UniProt: A0A385AXT1
Position
complement(5004876..5005268)
Genome map
AA seq 130 aa AA seqDB search
MRISPMKARRVVNLVRGLPAKEALTVLQFAPQAASEQVYKVLASAIANAENNERLDPDAL
LVSEAFVDEGPTMKRFRPRAQGRAYRIRKRTCHITVAVEAVAAATPKKSAKKAAPAKPAA
EEQSTTEGAE
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatctcgccgatgaaggcgcgccgggtggtcaacctcgtccgcggcctgcccgcg
aaggaggctctcacggtgctgcagttcgcgccgcaggctgcgagcgagcaggtgtacaag
gtgctcgcgagcgcgatcgccaacgcggagaacaacgagcggctggaccccgacgcgctg
ctcgtcagcgaggcgttcgtcgacgagggcccgaccatgaagcggttccggccgcgtgcg
cagggccgggcgtaccggatccgcaagcgcacctgccacatcaccgtggcggtcgaggcg
gtcgcggcggccacgccgaagaagtcggcgaagaaggccgctccggccaagccggcggct
gaggagcagagcacgacggagggtgccgagtaa

DBGET integrated database retrieval system