KEGG   Microbulbifer aggregans: AUP74_00232Help
Entry
AUP74_00232       CDS       T04560                                 

Gene name
pdhC_1
Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
micc  Microbulbifer aggregans
Pathway
micc00010  Glycolysis / Gluconeogenesis
micc00020  Citrate cycle (TCA cycle)
micc00620  Pyruvate metabolism
micc01100  Metabolic pathways
micc01110  Biosynthesis of secondary metabolites
micc01120  Microbial metabolism in diverse environments
micc01130  Biosynthesis of antibiotics
micc01200  Carbon metabolism
Module
micc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:micc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AUP74_00232 (pdhC_1)
   00020 Citrate cycle (TCA cycle)
    AUP74_00232 (pdhC_1)
   00620 Pyruvate metabolism
    AUP74_00232 (pdhC_1)
Enzymes [BR:micc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AUP74_00232 (pdhC_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl ZnuA
Motif
Other DBs
NCBI-ProteinID: AOS95704
UniProt: A0A1C9W3K4
Position
complement(262578..263774)
Genome map
AA seq 398 aa AA seqDB search
MREGESLYSLESDKVNIDVEAEVSGILKQLVPAGQASDPGAVVAHIYAEDEKIPASAPAP
AVEEATAEINSGSGSLAGSAVSVAADYEIAVDRVRSTPAARKLAREQGVDYTAIKGSGPR
GRVIKSDVMRAAAEQETRASVSVKGQPVATAASRTGTSPDPASVVTPDEVSGQKIPLTNM
RRTIARRMSSSLQNTAQLTMTMEARVDELVKLRSLLLDEWQEEGIRPSYTDLIMKAVAKA
LAKYPMMNSQWRDDHIWVSPSVNIGMAVSVQDGLVVPVLRDVNQLTVGQVAMESKRLASY
ARNGTLPPDAFAGGTFTVSTLGMYGVDSFTPILNEPQVGILGVNRIYDGVEWEGDTPVKA
KKMNLSLTWDHRVLDGAPAAEFLQSVVQLLENPFRLLV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtgagggcgaaagcctctactccctggagtccgataaggtcaacatcgacgtggaa
gcggaagtgtcgggtatcctgaaacagttggtgccggcggggcaggcgagtgatcccggc
gcggtggttgcccatatttatgccgaagacgagaaaatcccggcgagtgcaccggcgcct
gctgttgaagaggcaacggcggaaataaattcaggatccggatccttggcaggcagcgca
gtttcggttgccgccgattatgaaatcgcggtagaccgggtccggtcgacacctgccgca
cgcaagctcgcccgcgagcagggtgttgattacacggctatcaagggttccggtccgcga
ggccgggtcatcaagtcggacgttatgcgagcggccgcagaacaggaaacgcgagcgtcc
gtatctgttaaaggtcagccggtcgctacagcagcgtcgaggacgggcacatcacctgac
cctgcatcggttgtgacaccggatgaagtgtccggacaaaagataccgctcaccaatatg
cgccgcaccatcgcgcgacgcatgtcatcaagcctgcagaataccgcccagctgacgatg
accatggaagcgagggtggatgaactggtcaagttgcgctcactgttgttggatgagtgg
caggaggagggaatacgcccttcctataccgacctgatcatgaaggcggtcgccaaggcg
ctggcgaagtacccgatgatgaacagccagtggcgggatgaccacatctgggtttcaccc
tcggtcaatatcggcatggcggtatcggttcaggacggtcttgtggtgcctgtcttgcga
gacgtgaaccagctgaccgtcggccaggttgccatggagtcaaaacgcctcgcttcctat
gcgcgcaacggaaccctccccccggatgcatttgccggaggcacgtttacggtgagcacc
ctgggtatgtatggagtggattcctttacccccatcctgaatgagccccaggttggtatc
ctgggtgttaaccgcatctatgatggcgtcgagtgggaaggggatactccggtgaaggcg
aagaaaatgaatctgtcccttacctgggatcatcgggttcttgatggcgcaccagcggca
gagttcctgcaatctgttgtgcaattgctggaaaaccctttccggttgttggtttaa

DBGET integrated database retrieval system