KEGG   Microbulbifer aggregans: AUP74_01450Help
Entry
AUP74_01450       CDS       T04560                                 

Gene name
rluD
Definition
(GenBank) Ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
micc  Microbulbifer aggregans
Brite
KEGG Orthology (KO) [BR:micc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:micc03009]
    AUP74_01450 (rluD)
Enzymes [BR:micc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     AUP74_01450 (rluD)
Ribosome biogenesis [BR:micc03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AUP74_01450 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AOS96898
UniProt: A0A1C9W6Y9
Position
1639733..1640689
Genome map
AA seq 318 aa AA seqDB search
MTEQIQVDILVPAHLAGHRLDQVAAELIPEYSRARLQGWIKSGELTVNGRRAKPKDKLFG
GEQLVLRAELEPQGEWQAEDLSLDVVYEDGSLLVINKPAGLVVHPAAGNPDGTLLNGLLY
HCPALQNIPRAGIVHRLDKDTSGLMVVAKTLTAQANLVDQLKERSVSRLYDAVAQGAMTA
GGTVDAPIGRHRQNRLKMAVLSAGAAGAKEAVTHYRVVERFAAHTLLRCQLETGRTHQIR
VHMAHIRHPLVGDPLYGGRGRLPAGASPELVETLQSFPRQALHAAELSLQHPETGETLSW
SAAMPEDMLNLLERLRAG
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaacagattcaagtggacatcttagtacctgcccacctggccggtcacaggttg
gaccaggtagcagcggaattaattcccgagtattcccgcgcccgcctgcagggctggatc
aagagcggtgaactgaccgtcaacgggcgccgcgccaaacccaaggacaagctgttcggc
ggtgagcagcttgtcctgcgtgccgaactggagccgcagggggagtggcaggccgaggac
ctgtccctggacgtggtttacgaggacggcagcctgctggtgatcaacaagcccgcaggg
ctggtcgtgcatccggcagcggggaatcccgacggcaccctgttgaacggcctgctgtac
cactgcccagcgctgcaaaatattccccgtgccggcatcgtgcatcggctggacaaggac
accagtggcctgatggtggtggccaagacattgactgcccaggcaaacctggttgaccag
ctcaaggagcgctctgtcagccgcctttatgatgcagtggcccagggggccatgaccgca
ggaggtaccgtcgatgccccgatcggtcgacatcgacagaaccgcctgaagatggcggta
ctgtccgccggcgccgccggggccaaagaggcggtgacgcactatcgggtggtggagcgt
ttcgcagcgcataccctgctgcgctgtcagctggagaccggccgcacccatcagatccgg
gtccatatggcgcatatccgccatccgctggtcggggatccgctctacggcgggcgcggc
cgcctgcccgccggcgcctccccggaattagtcgagacgttgcaatcgtttccacgccag
gcgctacatgccgccgagctgtcactgcagcacccggaaaccggggagacgctgagctgg
agtgcagcgatgccggaggatatgctgaacttgctggagaggttacgggcaggctga

DBGET integrated database retrieval system