KEGG   Microbulbifer aggregans: AUP74_01747Help
Entry
AUP74_01747       CDS       T04560                                 

Gene name
aam_1
Definition
(GenBank) Acylamidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
micc  Microbulbifer aggregans
Pathway
micc00970  Aminoacyl-tRNA biosynthesis
micc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:micc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AUP74_01747 (aam_1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:micc03029]
    AUP74_01747 (aam_1)
Enzymes [BR:micc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AUP74_01747 (aam_1)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AUP74_01747 (aam_1)
Mitochondrial biogenesis [BR:micc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AUP74_01747 (aam_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOS97178
UniProt: A0A1C9W7R1
Position
1999459..2000901
Genome map
AA seq 480 aa AA seqDB search
MNDFVAMTALDLLQGYRDKSFSPVEVTEALLKQIERCNSTVNAYNLIDRETTLEFARASE
QRYQSGDTYGQLDGVPVAIKDVFLTPMWPTLKGSKTIDPKSTINKSAPAVAALERNGYVP
LGKTTTPEFGWKGVTDNPIDGVTRNPWNPDKTAGGSSGGSAAAVPLGMGPLALGTDAGGS
IRIPAGFCGHVGLKPSFGEVPHWPASPFGTLAHAGPMTWTVADCALMMNVLSEADDRDTN
AIPRRNIDYLAAIRGEPGDLLKGLKIAFSATLGYVQVDREVEETVRKAAHVLQSLGAEIV
EVAPGFDDPLAPFGHLFYGGAANALRDLNKRQRAQMDPQLVAVSEKAAQLSMLDYLGAVN
ERAALCERMVAFHRKYDLLLTPTLPITAFKAGREVPEDWPSTRWPSWTPFTYPFNLTGQP
ALSVPCGFSSDGLPIGLQIVGRKFDDATVLRAGQAYQLAAPLTDKRPELFYENAAEGAQA
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttcgtcgccatgaccgctctcgacctgctgcaaggctaccgggacaaatca
ttttcccccgtagaagtcaccgaggcgctgcttaaacagatcgagcgatgtaactccacc
gtcaacgcctacaacctgatcgaccgggaaaccaccctggaatttgcccgcgcctccgag
cagcgctatcagtcgggtgatacctacggccagctcgacggtgtgccggtggccatcaaa
gacgtgttcctcacacccatgtggcccaccctcaagggctcgaagaccatcgatcctaag
tcgaccatcaacaagtccgccccggcggtagcggcgctggagcgcaatggttacgtgcca
ctgggcaagaccaccacgccggaattcggctggaagggcgtcaccgataatcccatcgac
ggtgttacccgcaacccctggaacccggacaagaccgctggcggttccagtggtggcagt
gccgcggcagtaccactgggtatgggtccgctggcgctgggcaccgatgccggtggctcc
atccgtattccggccggtttctgcggtcatgtgggcctgaaacccagcttcggcgaagtg
ccgcactggcccgccagcccgttcggtaccctggcccatgccggccccatgacctggacc
gtggccgactgcgcgttgatgatgaatgtgctctccgaggcagacgatcgcgatacgaat
gccatcccgcgccgcaatatcgattacctggcggccattcgcggtgagcccggtgattta
ctaaagggcctgaaaatcgccttcagtgccaccctcggttacgtgcaggtggaccgggaa
gtggaagagacggtgcgcaaggccgcgcacgtgttgcagtccctcggcgcagagattgtg
gaagtggcgccgggcttcgacgatcccctggcgccgttcggccacctgttttatggcggc
gccgccaatgcgctgcgggacctcaacaagcgccagcgcgcacagatggatccgcaactg
gtggcggtgtcggaaaaggccgcccagctttccatgctcgattacctcggtgcggtgaat
gagcgcgccgcgctgtgcgagcgcatggtcgcgttccatcgcaagtacgacctgctgctc
acgcccacattgccgattaccgcgttcaaggccgggcgcgaagtgccggaagactggccc
agcacccgctggccctcctggacgccatttacctatccgttcaatctcaccggccagccg
gcactgtctgtaccctgcggcttctccagcgatggcctgcctatcggcctgcagattgtc
gggcgcaagttcgacgatgccaccgtgctgcgcgccggccaggcctatcagctggcggca
ccgctgaccgataaacgtccggaactcttctatgaaaatgcggctgagggggcgcaggcg
tga

DBGET integrated database retrieval system