KEGG   Microbulbifer aggregans: AUP74_02841Help
Entry
AUP74_02841       CDS       T04560                                 

Gene name
truC
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
micc  Microbulbifer aggregans
Brite
KEGG Orthology (KO) [BR:micc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:micc03016]
    AUP74_02841 (truC)
Enzymes [BR:micc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     AUP74_02841 (truC)
Transfer RNA biogenesis [BR:micc03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    AUP74_02841 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AOS98236
UniProt: A0A1C9WAQ2
Position
3249415..3250164
Genome map
AA seq 249 aa AA seqDB search
MPPADVKPATVPEVIYEDSDLIAAYKPEGWLVHRSNIDRHETQFLLQYLRDQTGAYLYPI
HRLDKPTSGVILFAKSSEVAARTQSLLESDAAVKTYIAVCRGYCPEEGVIDHPLPPVNDF
KHQRKRPKADQPRQDAVTLFRRLHTIELPYEVDRYPSSRYSLVEIQLKTGRRHQIRRHFK
HLSHPLIGCPKYGKSTHNRFFAEHFHCSRLLLHALELRLPHPVTGEPLVVREPPRGEFHT
LLERFGWQL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgccgccagccgacgtgaaaccggcaactgtgccggaagtgatttacgaagacagtgat
ctcattgcagcttataagccggagggctggctggtgcatcgatctaacatcgatcggcac
gagacacagtttctgctgcagtacctgcgggatcagactggagcgtacctgtacccgatt
caccgtctggataaaccgacgtcgggcgttattctgtttgccaagagtagtgaagtggca
gccaggacccagtcattgctggagagtgatgccgcggtgaaaacctatatcgccgtctgc
cgcggctattgtcctgaagagggcgttatcgaccaccccctgccgccagtcaacgatttc
aaacaccagaggaagcgccccaaggccgatcaaccgcgccaggacgctgtcaccctgttc
cggcggctgcacaccatcgagctgccttacgaagtcgaccgctatcccagcagccgctat
tccctggtcgagatccagttaaagaccggacgaaggcaccagatccgaaggcacttcaag
catctctcgcacccgctgatcggctgcccaaagtacggcaaatcaactcacaaccgtttt
tttgccgagcatttccactgcagccggctactgctgcacgccctggagttgcgtctcccc
catccggttaccggtgaaccgttggtagtgcgcgagcctccgcgaggagagtttcataca
ctactggagaggttcggttggcagttgtaa

DBGET integrated database retrieval system