KEGG   Microbulbifer aggregans: AUP74_03310Help
Entry
AUP74_03310       CDS       T04560                                 

Gene name
fadI
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
micc  Microbulbifer aggregans
Pathway
micc00071  Fatty acid degradation
micc00072  Synthesis and degradation of ketone bodies
micc00280  Valine, leucine and isoleucine degradation
micc00310  Lysine degradation
micc00362  Benzoate degradation
micc00380  Tryptophan metabolism
micc00620  Pyruvate metabolism
micc00630  Glyoxylate and dicarboxylate metabolism
micc00640  Propanoate metabolism
micc00650  Butanoate metabolism
micc00900  Terpenoid backbone biosynthesis
micc01100  Metabolic pathways
micc01110  Biosynthesis of secondary metabolites
micc01120  Microbial metabolism in diverse environments
micc01130  Biosynthesis of antibiotics
micc01200  Carbon metabolism
micc01212  Fatty acid metabolism
micc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:micc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AUP74_03310 (fadI)
   00630 Glyoxylate and dicarboxylate metabolism
    AUP74_03310 (fadI)
   00640 Propanoate metabolism
    AUP74_03310 (fadI)
   00650 Butanoate metabolism
    AUP74_03310 (fadI)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AUP74_03310 (fadI)
   00072 Synthesis and degradation of ketone bodies
    AUP74_03310 (fadI)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AUP74_03310 (fadI)
   00310 Lysine degradation
    AUP74_03310 (fadI)
   00380 Tryptophan metabolism
    AUP74_03310 (fadI)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AUP74_03310 (fadI)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AUP74_03310 (fadI)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AUP74_03310 (fadI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:micc04147]
    AUP74_03310 (fadI)
Enzymes [BR:micc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AUP74_03310 (fadI)
Exosome [BR:micc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AUP74_03310 (fadI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AOS98676
UniProt: A0A1C9WBZ3
Position
3751132..3752415
Genome map
AA seq 427 aa AA seqDB search
MQIGEPRRVAIVGANRIPFARSNTAYADLSNQTMLTDTLRGLIEKCGLKGEKLGEVAGGA
VQKHASDWNLVRESVLGCGLDPHTPAYDIQQACGTSLEATILVANKIALGQIDCGIACGT
DTTSDIPMGASHDLRRALVKLNAARTTGDRLKAALKLLNPKHLVPEMPTGAEPRTGKTMG
QHAQITAKKFGISREAQDELALASHQNLAEAYDAGFFDDLVMPYHGLKRDNNLRADATLE
KMAKLKPAFDREHGTITAANATPFTDGASAVLLASEDWARERDLPILAYITSGEVAAVDY
VDGNEGLLMGGAYAIPRMLAKRGLSLQDFDYYEIHEAFAAVVLCTLAALESDEFCREKLG
LEQALGSIDRSKLNVKGSSIATGHPFAATGGRIVATLAKILNEKGSGRGLISVCAAGGQA
VTAILEK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcggtgaacccagacgcgtcgccattgtcggcgccaaccgcattccgtttgca
cgctccaatacggcctatgccgatctcagcaaccagaccatgctcaccgacaccctgcgc
gggctcatcgagaaatgcggcctgaagggcgagaagctcggcgaggtagctggcggtgcg
gtgcagaaacacgccagcgactggaatctggtgcgggaatcggtacttggctgcggactg
gacccgcatacgcccgcgtatgatatccagcaggcctgcggcaccagcctcgaagccacc
attctggtcgcgaacaagattgccctcgggcagatcgattgcggcattgcctgcggcacg
gatacaacctcagatattcccatgggggccagccacgaccttcgtcgcgcgctggtaaaa
ctcaacgccgcccgcaccaccggagaccggctcaaagccgccctcaaactgctgaacccg
aaacacctggtgcccgaaatgcccaccggggccgaaccccgcaccggcaagaccatgggc
cagcacgcccagatcacagcgaagaaattcggtatcagccgtgaggcccaggacgagctg
gcactggccagccaccagaacctggccgaggcctatgacgcgggtttcttcgatgatctg
gtgatgccctaccacgggctgaaaagggataacaacctgcgtgcagatgcgacgctggag
aagatggccaaactgaaacccgccttcgaccgcgaacacggcaccattaccgccgccaat
gccacccccttcaccgatggtgcttccgcggtgctgctggcgagcgaggactgggccagg
gagcgggaccttcccattctcgcttacatcacttccggcgaggttgccgccgttgactac
gtagacggcaacgaggggttgctgatggggggcgcctacgccattccgcgcatgctggcc
aagcgcggcctctccctgcaggacttcgattactacgagattcacgaggctttcgccgcg
gtggtgctgtgcacactggcggcgctggaatccgatgaattctgccgtgaaaagctcggg
ctcgagcaggctctcggcagcatcgaccgcagcaagctcaatgtgaaaggcagctccatc
gccaccggtcacccctttgctgccaccggcggacgaatcgttgccaccctggcaaagatt
ctcaatgaaaagggctccggccgtgggctgatctccgtctgtgccgccggcggccaggcg
gtgaccgccatccttgaaaaataa

DBGET integrated database retrieval system