KEGG   Micromonospora sp. HM134: FJK98_04225Help
Entry
FJK98_04225       CDS       T06145                                 

Definition
(GenBank) 23S rRNA methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
mich  Micromonospora sp. HM134
Brite
KEGG Orthology (KO) [BR:mich00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:mich03009]
    FJK98_04225
Enzymes [BR:mich01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     FJK98_04225
Ribosome biogenesis [BR:mich03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    FJK98_04225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Methyltransf_12 zf-NADH-PPase Methyltransf_4 DNA_ligase_ZBD
Motif
Other DBs
NCBI-ProteinID: QDY06471
UniProt: A0A518WBB9
Position
complement(861060..862001)
Genome map
AA seq 313 aa AA seqDB search
MTAPHPFEQPVDATHPQIVARLRCPVCARPLAAATDTRALRCPRRHSFDLARQGYVTLLA
GRAPHVGDTADMVAARADFLAAGHYDVISSALAEAAASALATPTGPAEASGNADGAERAG
FGAYPLVVEAGAGTGRHLAAVLAAWPDAVGLALDVAKPALRRAARAHPRAAAALADTWQR
LPLADRSVAVLLDVFAPRNGDEFHRVLHPAGVLLVVTPTDAHLAELVDVLGLLRVDPAKA
DRVADSLAGRFTPEHTAVHTARLSLDRAEVGTLVGMGPSAWHTDPARLAAAIDALPTPVA
VTASVRLTTWRPR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgccgcacccgttcgagcagcccgtcgacgcgacgcacccgcagatcgtcgcc
cggctgcgctgcccggtctgcgcccggccgctggccgccgccaccgacacccgcgccctg
cgctgcccccgccggcacagcttcgacctggcccgccaggggtacgtcaccctgctcgcc
ggccgtgccccgcacgtcggggacaccgccgacatggtcgccgcccgggccgacttcctg
gccgccgggcactacgacgtgatctcgtccgcgctggccgaggcggcggcgtccgccctg
gcgacaccgaccggccccgccgaggcgagcgggaacgctgacggggcggagcgggcgggc
ttcggggcgtacccgctggtcgtggaggccggggcgggcaccggccggcacctcgcggcg
gtgctggcggcatggcccgacgccgtcggcctggccctggacgtcgccaagccggcgctg
cgccgtgctgcccgcgcccacccgcgcgccgccgccgcgctcgccgacacctggcagcgg
ttgccgctggccgaccggtcggtcgccgtgctgctcgacgtcttcgccccgcgcaacggc
gacgagttccaccgggtgctgcacccggccggggtgctgctggtggtcacccccaccgac
gcccacctcgccgaactggtcgacgtgctcgggctgctgcgggtcgacccggccaaggcc
gaccgggtcgccgacagcctcgccgggcggttcacgccggagcacaccgccgtgcacacc
gcccggctcagcctcgaccgggccgaggtcggcaccctggtcgggatggggccgagtgcc
tggcacaccgacccggcgcggctcgccgccgcgatcgacgcgctgcccacgccggtcgcc
gtgaccgcgtcggtacgcctgaccacctggcgtccccgctga

DBGET integrated database retrieval system