KEGG   Micromonospora sp. HM134: FJK98_15735Help
Entry
FJK98_15735       CDS       T06145                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
mich  Micromonospora sp. HM134
Pathway
mich00740  Riboflavin metabolism
mich00790  Folate biosynthesis
mich01100  Metabolic pathways
mich01110  Biosynthesis of secondary metabolites
mich02024  Quorum sensing
Module
mich_M00125  Riboflavin biosynthesis, GTP => riboflavin/FMN/FAD
Brite
KEGG Orthology (KO) [BR:mich00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    FJK98_15735
   00790 Folate biosynthesis
    FJK98_15735
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    FJK98_15735
Enzymes [BR:mich01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     FJK98_15735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2 TrkA_N
Motif
Other DBs
NCBI-ProteinID: QDY08428
UniProt: A0A518WGR4
Position
complement(3709214..3709870)
Genome map
AA seq 218 aa AA seqDB search
MYDALPAATVRTQVTVPLRFPDGYATTARVFSFDGLVDGREHLAFGLGDWAGALRRHAAG
GAAPLVRPHSECLTGDVFGSQRCDCGPQLREAVQRISDAGGFLLYLRQEGRGIGLYPKLD
AYALQDAGLDTYEANVALGHDEDERDYRAAAQMLTVLGVPELVLLSSNPDKAEQLTRLGV
AVAEVVPTGVFLSPANADYLAAKASRAAARAVDLPSLN
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacgcactgccggccgcgacggtccggacacaggtcacggtcccgctgcggttc
cccgacgggtacgccaccacggcccgggtcttctccttcgacgggctggtggacgggcgg
gagcacctggcgttcgggttgggcgactgggcgggcgcgctgcgccggcacgcggcgggc
ggggcggcgccgctggtccgtccgcacagcgagtgcctgaccggggacgtcttcggcagt
cagcgctgcgactgcggcccgcaactgcgcgaggcggtgcagcggatctccgacgccggt
ggtttcctgctctacctgcggcaggagggacgcggcatcggcctctacccgaagctggac
gcgtacgccctgcaggacgccgggttggacacctacgaggcgaacgtggcgctcgggcac
gacgaggacgaacgggactaccgggccgccgcgcagatgctgacggtgctcggggtgccg
gagctggtgctgctgagcagcaacccggacaaggccgagcagttgacccggttgggggtg
gcggtggccgaggtggtgccgaccggggtgttcctctcccccgccaacgccgactacctg
gcggcgaaggccagccgggccgccgcccgggccgtcgacctgccgtcgttgaactga

DBGET integrated database retrieval system