KEGG   Micromonospora sp. HM134: FJK98_26290Help
Entry
FJK98_26290       CDS       T06145                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
mich  Micromonospora sp. HM134
Pathway
mich00860  Porphyrin and chlorophyll metabolism
mich01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mich00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    FJK98_26290
Enzymes [BR:mich01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     FJK98_26290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 DJ-1_PfpI GATase SNO Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: QDY10220
UniProt: A0A518WLW2
Position
complement(6080011..6081555)
Genome map
AA seq 514 aa AA seqDB search
MSGGLLVAGTTSDAGKSVLTAGICRWLHRAGVAVAPFKAQNMSNNSAVVVGPDGRGGEIG
RAQAMQAAACGLVPDLRFNPVLLKPGSDLASQVVLLGEAVDTVTAGNFRALRPKLAETAY
AALAELRATYDVVICEGAGSPAEINLRAGDYVNMGLARHAGLPTIVVGDIDRGGVFASMF
GTVALLDPADQALIAGFVINKFRGDLGLLRPGLDMLHRVTGRPTYGVLPWHLDLWLDAED
SLAYGRVLGRPAAPHGTDWLDVAVVRLPRISNATDVEALATEPGVRVRLTVEPAELAAAD
LVVLPGSKSTVADLAWLRETGLAEAVTAHAAAGRPLLGICGGFQMLATAIHDPVESRRGS
VPGLGLLPIEITFDPVKTVRPAVGTAAPDVPVRGYEIHHGYVSTADADLPPLLHHADGRP
EGARLGAVHGTHWHGAFESDEFRRRFLTEVARSACRHGFTVAPGTSFDAARERSLDLLGD
LVEEHLDTAALWRLIETGAPADLPFIPPGAPPTT
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
gtgagcggcgggctgctcgtcgcgggcaccacctccgacgcgggcaagagcgtgctcacc
gccggcatctgccgctggctgcaccgggccggcgtcgccgtggccccgttcaaggcgcag
aacatgtccaacaactccgccgtcgtggtcggcccggacgggcggggcggcgagatcggg
cgggcccaggcgatgcaggccgccgcctgcggtctcgtccccgacctgcggttcaacccg
gtgctgctcaagcccggcagcgacctggccagtcaggtggtgctgctcggcgaggccgtc
gacacggtcaccgccggcaacttccgggccctgcgtccgaagctcgccgagacggcgtac
gcggccctggccgaactgcgggcgacgtacgacgtggtgatctgcgagggggcgggcagc
cccgccgagatcaacctgcgggccggcgactacgtcaacatggggctcgcccggcacgcc
ggtctccccacgatcgtggtcggcgacatcgaccggggcggcgtgttcgcctcgatgttc
ggcacggtggccctgctcgaccccgccgaccaggcgctgatcgccggcttcgtgatcaac
aagttccggggtgatctcgggctgctccgccccgggctcgacatgctgcaccgggtgacc
ggccggcccacctacggggtgctgccctggcacctcgacctgtggctcgacgcggaggat
tcgctcgcctacggccgggtgctcggccggcccgccgccccgcacggcaccgactggctc
gacgtggcggtggtccggctgccccggatcagcaacgccaccgacgtggaggccctcgcc
accgaaccgggcgtgcgggtccggctcaccgtcgagcccgccgaactggccgccgccgac
ctggtcgtcctgcccggctcgaagtccaccgtcgccgacctggcctggctgcgggagacc
gggctcgccgaggcggtcaccgcgcacgccgccgccggccggccgctgctgggcatctgc
ggcggcttccagatgctggccacggccatccacgacccggtggagagccgccggggcagc
gtccccggcctgggcctgctccccatcgagatcaccttcgacccggtcaagaccgtccgc
cccgccgtcggcaccgccgcgccggacgtcccggtacgcggctacgagatccaccacggg
tacgtctccaccgccgacgcggacctgccgccgctgctgcaccacgccgacggccgcccc
gagggcgcgcggctcggcgcggtgcacggcacccactggcacggcgcgttcgagtccgac
gagttccgccgccggttcctgaccgaggtggcccggtcggcttgtcggcacggcttcacc
gtcgcaccgggcaccagtttcgacgccgcccgcgaacgctccctcgacctgctcggcgac
ctggtcgaggagcacctcgacaccgccgcgctgtggcggctcatcgagaccggcgccccc
gccgatctgccgttcatcccacccggcgcaccaccgacgacctga

DBGET integrated database retrieval system