KEGG   Micrococcus sp. KBS0714: B1A86_00001895Help
Entry
B1A86_00001895    CDS       T06141                                 

Definition
(GenBank) zinc-binding dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
mick  Micrococcus sp. KBS0714
Pathway
mick00625  Chloroalkane and chloroalkene degradation
mick00680  Methane metabolism
mick01100  Metabolic pathways
mick01120  Microbial metabolism in diverse environments
mick01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mick00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    B1A86_00001895
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    B1A86_00001895
Enzymes [BR:mick01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     B1A86_00001895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N PALP AlaDh_PNT_C ADH_N_assoc
Motif
Other DBs
NCBI-ProteinID: QDW16725
UniProt: A0A229HM44
Position
complement(415103..416296)
Genome map
AA seq 397 aa AA seqDB search
MTTKNRAVAFHGIKDVRVDELDFPKLEMPDGSAAPHGVILKIVATNICGSDLHIYRGSFP
APEGMVLGHEMTGQVLEVGSDVQFLQEGDLVSVPFNVACGRCRNCRAGRTEICETANPDQ
ACAAYGFNLGGFQGGQAEYLFVPYADFQLLRFPDQEQAMEKILDLTVLSDILPTAFHGLV
EAGAKPGSTVYIAGAGPVGRCAAAAARLLGASCIIVGDQDASRLELVRKHGCETIDLSTT
ENLQDAVSDILGEPMVDCAVDCVGSEAHGLGSASDEMQPIAAVNQVLDITRPGGATGIIG
IYGPDPIAETKAEQEGTFPVDFGKAWIKSPHIIGGQAPVMRYNRQLMMSILWDRMPYLTE
MVNPRVISLDEAPQAYAEFDQGSLEKFVIDPHGMIAR
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccaagaaccgcgccgtggcattccacggcatcaaggacgtgcgcgtcgacgag
ctggacttccccaagctggagatgcccgacggctccgccgcgccgcacggtgtcatcctc
aagatcgtcgcgaccaacatctgcggcagcgacctgcacatctaccgcgggtccttcccc
gcccccgagggcatggtgctgggtcacgagatgaccggccaggtgctggaggtcggcagc
gacgtccagttcctgcaggagggcgacctcgtctccgtgccgttcaacgtggcctgcggc
cgttgccgcaactgccgcgccggccggaccgagatctgcgagaccgccaacccggaccag
gcctgcgccgcctacggcttcaatctgggcggcttccagggcgggcaggccgagtacctg
ttcgtgccgtacgccgacttccagctgctgcgcttcccggaccaggagcaggcgatggag
aagatcctggatctgaccgtgctctcggacatcctcccgacggcgttccacggcctcgtg
gaggccggcgccaagcccggctccaccgtctacatcgccggtgccggccccgtgggccgg
tgcgccgcggccgccgctcggctgctgggcgcctcgtgcatcatcgtgggcgaccaggac
gcctcgcgactggagctggtgcgcaagcacggctgcgagaccatcgacctctccaccacg
gagaacctgcaggacgccgtgagcgacatcctcggcgagccgatggtggactgcgcggtg
gactgcgtcggctccgaggcccacggcctgggctccgcgtccgatgagatgcagccgatc
gccgccgtgaaccaggtcctggacatcacccgtccgggcggcgccacgggcatcatcggc
atctacgggccggacccgatcgcggagacgaaggccgagcaggagggcaccttcccggtg
gacttcggcaaggcctggatcaagtcgccccacatcatcggcggccaggcgcccgtcatg
cgctacaaccgccagctgatgatgtcgatcctgtgggatcggatgccgtacctgacggag
atggtcaacccgcgcgtgatcagcctggacgaggcaccgcaggcctatgcggagttcgac
cagggctccctggagaagttcgtcatcgacccccacggcatgatcgcccgctga

DBGET integrated database retrieval system