KEGG   Micrococcus sp. KBS0714: B1A86_00004105Help
Entry
B1A86_00004105    CDS       T06141                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
mick  Micrococcus sp. KBS0714
Pathway
mick00020  Citrate cycle (TCA cycle)
mick00620  Pyruvate metabolism
mick01100  Metabolic pathways
mick01110  Biosynthesis of secondary metabolites
mick01120  Microbial metabolism in diverse environments
mick01130  Biosynthesis of antibiotics
mick01200  Carbon metabolism
Module
mick_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mick_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mick00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    B1A86_00004105
   00620 Pyruvate metabolism
    B1A86_00004105
Enzymes [BR:mick01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     B1A86_00004105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO DUF2298
Motif
Other DBs
NCBI-ProteinID: QDW17123
UniProt: A0A229HCR3
Position
complement(897225..898709)
Genome map
AA seq 494 aa AA seqDB search
MPTTSSTATHDVVLIGGGIMSATLGVLLQKLEPTWSIALYESLDQAGLESSDPWNNAGTG
HAALCELNYSPMDKNGRVDVTKALGINEQFWTTRQFWSSLVADGTLKDPKSFINPLPHMS
FVWGDDHADYLRTRYEAMSAQPLFAGMEHSEDPEQIRAWAPLLIEGREPGQRLAASRNTG
GTDVDFGSLTRQLITAMAGAGAEVRFGHKVTGLTRGTDGRWEVKVKNKAAGSELVDRARF
VFVGAGGGALPLLQKSGIPEAKGFGGFPVSGQFLRCTDESVVNQHMAKVYGQAAVGAPPM
SVPHLDTRFVNGKRSLLFGPYAGFSTNFLKTGSYLDLPLSVRPHNLSTMLDVAKDNMDLT
KYLVTEVLKSRDKKIDALHEFYPEADGGEWELITAGQRVQVMKRKGRFGGVLQFGTEVVT
HADGSLGGLLGASPGASTAAPIMVKLLERCFPAKMAGWDGTLKELIPSLGHTLNDDPALL
DEVRTVTDAALKLA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaccacctcgtccaccgccacccacgacgtcgtcctgatcggcggcggcatcatg
agcgccaccctgggcgtgctgctgcagaagctcgagcccacctggtccatcgccctgtac
gagagcctcgatcaggccggcctggagtcctccgacccgtggaacaacgcgggcaccggc
cacgccgccctgtgcgagctgaactactcgcccatggacaagaacggacgggtggacgtc
accaaggcgctgggcatcaacgagcagttctggaccacccgccagttctggtcctccctg
gtggcggacggcacgctcaaggaccccaagtccttcatcaacccgctgccgcacatgtcc
ttcgtgtggggtgacgaccacgcggactacctccgcacccgctatgaggccatgtccgcc
cagccgctgttcgccggcatggagcacagcgaggacccggagcagatccgtgcctgggcc
ccgctgctgatcgagggccgtgagccgggccagcgcctggcggcgtcccgcaacaccggc
ggcaccgacgtcgacttcggctccctcacccgccagctcatcacggccatggccggcgcc
ggcgccgaggtgcgcttcggtcacaaggtcaccggcctcacccgcggcacggacggccgc
tgggaggtcaaggtcaagaacaaggccgccggctccgagctcgtggaccgcgcccgcttc
gtcttcgtcggtgccggcggcggcgccctgcccctgctgcagaagtccggcatccccgag
gccaagggcttcggcggcttcccggtctccggccagttcctgcgctgcacggacgagtcc
gtggtcaaccagcacatggccaaggtgtacggccaggccgccgtcggcgccccgccgatg
tccgtgccccacctggacacccgcttcgtcaacggcaagcgctccctgctgttcggcccc
tacgccgggttctccacgaacttcctcaagaccggctcctacctggacctgccgctgtcc
gtgcgcccgcacaacctcagcacgatgctggacgtggccaaggacaacatggacctgacc
aagtacctcgtgaccgaggtgctgaagtcccgggacaagaagatcgacgcgctgcacgag
ttctacccggaggccgacggcggcgagtgggagctgatcaccgcgggccagcgcgtgcag
gtgatgaagcgcaagggccgcttcggcggcgtcctgcagttcggcaccgaggtcgtcacg
cacgcggacggctcgctcggcggcctgctcggcgcctcgccgggcgcctccaccgcggcc
cccatcatggtgaagctgctcgagcgctgcttccccgcgaagatggccggctgggacggc
acgctcaaggagctcatcccgtccctgggccacacgctcaacgacgacccggcgctgctg
gacgaggtccgcaccgtcacggacgccgcactgaagctggcctga

DBGET integrated database retrieval system