KEGG   Microbacterium sp. 1.5R: BMW26_03795Help
Entry
BMW26_03795       CDS       T04912                                 

Definition
(GenBank) hypothetical protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
micr  Microbacterium sp. 1.5R
Pathway
micr00520  Amino sugar and nucleotide sugar metabolism
micr01100  Metabolic pathways
micr01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:micr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BMW26_03795
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    BMW26_03795
Enzymes [BR:micr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BMW26_03795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: APH44183
Position
809578..811089
Genome map
AA seq 503 aa AA seqDB search
MTDDLVRLANGVLWPGFLGTEAPEWLLDELRDGLAGVMYFSQNVGEGLPALSDEILRANP
DALIGIDEEGGNVTRLESAAGSTLPGAAQLGIVDDVEATRASGAELARRVAAIGGNVVLG
PVADVNTDPRNPVIGVRSFGSDQKLVARHVQAAVEGLQSTAVAACVKHFPGHGDTHTDSH
HALPEISLGIEELERVHLEPFRAAVAAGVDAVMTAHIVVPAWGAEPATLNPRVLGLLRGW
GFDGVIITDALDMAAIRETVGIGEGAARALAAGADLLCIGNPTNRGEATLPDQDRRDFLA
ARDGILAAVDDGSLSRERLAEAAGRVSRLAQTLSVRAETATPVDYDGSDIVRRAITGVTR
DAEALAVVDARRRSTLAVDSASAYVAETLAADGHRVRVDVARTTIDEQDGALDAAVAADG
LTVVLVDRPDTDDGQRALVERAALRDPDAVVVNVGLAARRPLPLALVEVGSASRIGAQAA
RDRLIGGSSRRADPSPDSAGAAD
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgacctcgtccgcctcgccaacggggtgctctggccggggttcctcggcacg
gaggcccccgaatggcttctcgacgagctgcgcgacggcctcgcgggtgtcatgtacttc
agtcagaacgtcggcgagggacttccggctctgagcgacgagatcctccgggccaatccg
gacgcgctgatcgggatcgacgaggagggcggcaacgtcacacgcctcgagtccgcagcc
ggctccacgcttccgggggcggctcagctgggcatcgtcgacgacgtcgaggcgacacgg
gcatcgggtgccgagctggctcgacgagtggccgcgatcggcggcaacgtcgtgctcggt
cccgtcgcggatgtgaacaccgatccgcggaatcctgtgatcggcgtccgttccttcggc
agcgaccagaagctcgtcgcccgacacgtgcaggcggcggtggagggactgcagagcacg
gcggtcgcggcgtgcgtcaagcacttcccggggcacggtgacacgcacaccgactcgcac
cacgcactgcccgagatctcgctggggatcgaggagctcgagcgcgtgcacctcgagccg
ttccgcgcggcggtggccgcaggtgtcgacgccgtcatgaccgcgcacatcgtcgttccc
gcctggggcgccgagccggcgacgctgaacccccgagtgctcgggctgctccgtggctgg
ggcttcgacggcgtgatcatcacggatgccctcgacatggcggccatccgcgagaccgtc
ggcatcggcgaaggcgccgcgcgtgccctcgcggccggagcggatctgctgtgcatcggc
aacccgacgaaccgcggtgaggccacgctccccgaccaggaccgtcgagacttcctcgcc
gcgcgcgacgggatcctcgcggcggtggacgacggctcactctctcgcgagcgactcgcc
gaagcggccgggagggtctcccgcctggctcagacgctgagcgtccgtgccgagactgcg
actcccgtcgactacgacggatcggacatcgtccgacgcgcgatcacaggagtgacgcgc
gatgccgaggcgctcgccgtcgtcgacgctcgccgacgttcgacgctcgcggtcgacagc
gcgtcggcgtacgtggctgagactctggcggcagacggtcatcgcgtgcgcgtcgacgtc
gcacggacgacgatcgacgagcaggatggggctctcgacgcggctgtcgcggcagacgga
ctgacggtcgtcctcgtggatcgtccagacaccgacgacgggcagcgtgcgctcgtcgag
cgcgccgctctgcgtgatcccgacgcggtcgtggtcaacgtcggactcgcggcacggcgg
cctctgcccctcgcgctcgtggaggtcggatccgcgagccggatcggagcccaggccgcc
agagatcgactgatcgggggctcgtcgcgccgcgccgatccgtcgcccgacagcgcaggt
gccgccgactga

DBGET integrated database retrieval system