KEGG   Microbacterium sp. 1.5R: BMW26_06970Help
Entry
BMW26_06970       CDS       T04912                                 

Definition
(GenBank) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
micr  Microbacterium sp. 1.5R
Brite
KEGG Orthology (KO) [BR:micr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BMW26_06970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4 DUF2244
Motif
Other DBs
NCBI-ProteinID: APH44728
Position
1500092..1501471
Genome map
AA seq 459 aa AA seqDB search
METAALIVVLVILLALFFDFTNGFHDTANAMATPIATGALKPKTAVLLAAVLNLVGAFLS
TEVSKTVSHGIIREDTIQGDVFLPMIFAGLIGAITWNMLTWLLGLPSSSSHALFGGLIGA
TLVGVGVNGIDFGMVLSKIILPALIAPLTAGIIAFAATKLAYSITRRYDGKPDGRDGFRW
GQIFTSSLVALAHGTNDAQKTMGVITLALITVGWQSSEQADPYLWVIIACAVTIALGTYL
GGWRIIRTLGKGLTEVKPAQGFSAESSTAATILASSAFGFALSTTQVASGSVIGSGLGRR
GSTVRWRTAGRIAIGWLLTLPAAGAVGALAALLITWLGLWGIAIDAVLALAVIIGLFLRS
RKDAVTSANAMSDVAESGLAIEHPDTPPPTRRQQRIIEAKAEAKARAEAREKVKAQAKAD
AKAKAAAKAAKKAPKTGASTRVDGPGVDSPETAKSEESK
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtggaaaccgcagccctcatcgtcgtgctggttatcctgctggcactcttcttcgacttc
accaacgggtttcacgacaccgccaacgcgatggccacgcccatcgcgacaggcgcgctg
aagcccaagaccgctgtccttctcgcagcagtcctcaacctcgtcggagcattcctgtcg
acggaggtctccaagaccgtgtcgcacgggatcatccgcgaggacacgatccaaggcgac
gtgttcctgccgatgatcttcgccggtctcatcggcgcgatcacctggaacatgctgacc
tggctgctgggtctgccctcgagctcgtcccacgcgctgttcggcggcctcatcggagcc
accctggtcggcgtcggagtcaacggcatcgacttcgggatggtgctctcgaagatcatc
ctcccggcgctcatcgccccgctgacggccggcatcatcgccttcgcggcgaccaagctc
gcgtactcgatcacgcgacgctacgacggcaagcccgacgggcgcgacggcttccgctgg
ggacagatcttcacgtcgtcactggtcgcactcgcgcacggcacgaacgacgctcagaag
acgatgggcgtgatcaccctcgcgctgatcactgtcgggtggcagagcagcgagcaggcc
gatccgtacctctgggtcatcatcgcctgtgcggtgacgatcgccctcggcacctatctc
ggcgggtggcgcatcatccgcacgctgggcaaggggctgaccgaggtcaagcccgcgcag
ggcttctcggccgagagttcgacggcagcgacgatcctcgcctccagcgctttcggcttc
gcgctctcgacgacgcaggtcgcttcgggctcggtcatcggctccggcctcggccgccgc
ggctcgacggtccgctggcggaccgccggtcgaatcgccatcggctggctcctcacactt
ccggctgcaggtgcagtcggtgccctcgcggccctgctcatcacctggctcggcctctgg
ggcatcgcgatcgacgcggtccttgcgctggccgtgatcatcggcctgttccttcgctcc
cgcaaggatgcagtgacctccgcgaacgccatgagcgatgtggccgagtcggggctcgcg
atcgagcaccccgacacgcccccgcccacgcgtcgacagcagcggatcatcgaggccaag
gccgaggccaaggctcgtgcggaggcgcgcgagaaggtcaaggctcaggccaaggcggac
gccaaggcgaaggcagcggccaaggccgcgaagaaggccccgaagacgggagcctcgacg
cgggtcgacggccccggggtcgacagtcccgagacggcgaagagcgaggagtcgaagtga

DBGET integrated database retrieval system