KEGG   Microbacterium sp. 1.5R: BMW26_11755Help
Entry
BMW26_11755       CDS       T04912                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
micr  Microbacterium sp. 1.5R
Pathway
micr00450  Selenocompound metabolism
micr00970  Aminoacyl-tRNA biosynthesis
micr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:micr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BMW26_11755
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BMW26_11755
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:micr01007]
    BMW26_11755
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:micr03016]
    BMW26_11755
Enzymes [BR:micr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BMW26_11755
Amino acid related enzymes [BR:micr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BMW26_11755
Transfer RNA biogenesis [BR:micr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BMW26_11755
 Prokaryotic type
   Other AARSs
    BMW26_11755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: APH45550
Position
complement(2459345..2460922)
Genome map
AA seq 525 aa AA seqDB search
MPAGESFYITTPIYYPSDVPHIGHGYTSVAVDALARWHRQGGDDTWMLTGTDEHGQKMLR
AAAANNVTPQEWVDKLVTEAWFPLLETLDVANDDFIRTTQERHEANVQTFFQRLYDRGYI
YAGEYEALYCVGCEEFKPESEIVDGTGPFEGLKVCAIHSKPLELLQEKNYFFKLSEFQDR
LLELYKTQPDFVRPDSARNEVVSFVSQGLKDLSISRSTFDWGIPLPWDESHVIYVWVDAL
LNYATAVGYGSDQETFDRRWPAYHVVGKDILRFHAVIWPALLMAAGLDVPKGVFAHGWLL
VGGEKMSKSKLTGIAPTEITDVFGSDAYRYYFLSAIAFGQDGSFSWEDLSARYQAELANG
FGNLASRTTAMIEKYFEGIVPPPADYTEKDLEIQRIVADAASNADAAIEQFRIDEAISSI
WTIVDALNGYITENEPWALARDESQRGRLGTVLYTCAEGLRALAVLLSPVMPQSTEKLWV
ALGAAESLGRLQDQPIREAGAWGVLRPGTSVNGLTPLFPRVESTA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaggcgaatcgttctacatcaccacgcccatctactacccctccgatgtgccc
cacatcggtcatgggtacacctcggtggcggtcgacgcgctcgcgcgctggcaccggcag
ggcggcgatgacacctggatgctgacgggcaccgacgagcacggccagaagatgctccgt
gccgcggccgcgaacaacgtcactccgcaggagtgggtcgacaagctcgtcaccgaggcg
tggttccccctgctcgagacgctcgacgtcgcgaacgacgacttcatccgcacgacgcag
gagcgccacgaggccaacgtgcagacgttcttccagcgtctctacgaccgtggctacatc
tatgcgggcgagtacgaggcgctgtactgcgtgggctgtgaggagttcaaacccgagtcc
gagatcgtcgacggcaccggtccgttcgagggcctcaaggtctgcgccatccactcgaag
ccgctcgagctgctgcaggagaagaactacttcttcaagctgagcgagttccaggaccgt
ctgctcgagctctacaagacccagcccgacttcgtgcgccccgattcggcgcgcaacgag
gtcgtctccttcgtcagtcagggtctcaaggacctctcgatctcgcgctcgacgttcgac
tggggcatcccgctgccgtgggacgagtcgcacgtcatctacgtgtgggtcgatgcgctg
ctcaactacgccaccgccgtcggctacggctccgatcaggagaccttcgaccgccgctgg
cccgcctatcacgtggtcggaaaagacatcctgcgcttccacgcggtgatctggccggct
ctgctgatggccgcagggctcgatgtgcccaagggcgtgttcgcgcacggctggctgctc
gtcggcggcgagaagatgtcgaagtcgaagctcaccggcatcgcgccgaccgagatcacc
gacgtcttcggatccgacgcctaccgctactacttcctctcggcgatcgcgttcggccag
gacggctcgttctcgtgggaggacctctcggcccgctaccaggcggagctcgccaacggc
ttcggcaacctcgcctcgcgcaccacggcgatgatcgagaagtacttcgagggcatcgtg
cctccgcccgccgactacaccgagaaggatctcgagatccagaggatcgtcgcggatgcc
gcctcgaatgcagatgccgcgatcgagcagttccgtatcgacgaggccatctcgtcgatc
tggacgatcgtcgacgctctcaacggctacatcacggagaacgagccgtgggcactggca
cgcgacgagtctcagcgcggccgtctcggcaccgttctctacacgtgcgccgagggactt
cgcgcgctcgccgtgctgctctcgcccgtgatgccgcagtcgacggagaagctctgggtc
gccctcggcgccgcagagagcctcggacgtctgcaggaccagccgatccgcgaggccgga
gcctggggcgtgctgcgtcccggcaccagcgtcaacggtctcaccccgctgttcccgcgc
gtggagtccaccgcctga

DBGET integrated database retrieval system