KEGG   Microbacterium sp. 1.5R: BMW26_15820Help
Entry
BMW26_15820       CDS       T04912                                 

Definition
(GenBank) hypothetical protein
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
micr  Microbacterium sp. 1.5R
Pathway
micr00860  Porphyrin and chlorophyll metabolism
micr01100  Metabolic pathways
micr01110  Biosynthesis of secondary metabolites
micr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:micr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BMW26_15820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:micr01007]
    BMW26_15820
Enzymes [BR:micr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     BMW26_15820
Amino acid related enzymes [BR:micr01007]
 Aminotransferase (transaminase)
  Class III
   BMW26_15820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: APH46252
Position
complement(3312913..3314241)
Genome map
AA seq 442 aa AA seqDB search
MTDRNDDLFSAARTVIPGGVNSPVRAYGSVGGTPRFLASASGATVTDAAGNRYVDLVASW
GPALLGHAHPEVVAAVQEAATRGLSFGAPTEGEVELAQLIADRVRFGEVRPVERVRLVST
GTEATMTAIRLARGATGRDLLVKFAGHYHGHSDGLLAAAGSGVATLALPGSAGVPAPIAA
QTLVIDYNDPDALAAVFAEHGPRIAAVIVEAAAANMGVVPPLPGFNRLLAETAHAHGALL
ILDEVLTGFRVHPAGFWGLQAAAGEDYLPDIITFGKVVGGGMPLAALGGRAEIMDLLAPL
GPVYQAGTLSGNPLSVAAGLATLRLATPEVYATVDAAAARVSRALDEALTEAGATHAVAH
AGNLFSASFRGSAPRDYTEAQAQQSFRYAPFFHAMREQGVALPPSVFEAWFLTAAHGEEE
LQRIEAALPVAARAAADAAATA
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaccgcaatgacgacctgttctccgctgcccgcacggtgatccccggaggggtg
aactcgccggtgcgcgcgtacggctcggtcggcggcacgccgcgcttcctcgcctcggcg
agcggcgcgacggtcacggatgccgcaggcaaccgctacgtcgacctcgtggcatcctgg
gggccggcgttgctcggccacgcgcacccggaggtcgtcgccgccgtgcaggaagcggcc
acccgaggcctttcgttcggcgctcccacggagggcgaagtcgagctcgctcagttgatc
gccgaccgcgtgcggttcggggaggttcggccggtggagcgggtgcggctcgtgtcgacc
ggaaccgaagcgacgatgacggcgatccggctcgcccgcggcgccaccggacgcgacctg
ctggtgaagttcgccgggcactatcacgggcactccgacggtctgctcgctgcggcgggc
tccggtgtcgcgacgctcgcgcttccgggttccgcaggtgtgcctgcgcctatcgcggct
cagacgctggtgatcgactacaacgatcccgacgctctcgcagctgtgttcgccgagcac
ggcccgcgcatcgcagcggtgatcgtcgaggccgcagcggcgaacatgggtgtcgttccg
ccgctgccggggttcaaccgcctgctcgccgagaccgctcacgcgcatggcgccctgctg
atcctcgacgaggtgctgacgggcttccgcgtgcacccggcgggcttctgggggctccag
gcggccgccggcgaggactatctgcccgacatcatcaccttcggcaaggtcgtcggcgga
gggatgccgctggctgcgctcggaggtcgtgcggagatcatggaccttctcgctcctctg
ggacccgtctaccaggcgggcacgctgtcgggtaacccgctgtcggtcgccgcgggtctc
gcgacgctgcgcctcgccacgccggaggtgtacgcgaccgtcgacgcggccgcagcgcga
gtctcccgcgccctggatgaggcgctcacggaggccggtgcgacccacgccgtcgcccat
gccggcaacctcttcagcgcctccttccgcggatctgcacctcgcgactacaccgaggct
caggcgcagcagtcgttccggtacgccccgttcttccatgcgatgcgcgagcagggcgtg
gcgctccctccgagcgtgttcgaggcgtggttcctcaccgccgctcacggtgaggaagag
ctgcagcgcatcgaggcagctctgcccgtggctgcgcgcgccgcagctgatgccgccgcg
actgcctga

DBGET integrated database retrieval system