KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_00416Help
Entry
MIP_00416         CDS       T02325                                 

Definition
(GenBank) (S)-2-haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00361  Chlorocyclohexane and chlorobenzene degradation
mid00625  Chloroalkane and chloroalkene degradation
mid01100  Metabolic pathways
mid01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MIP_00416
   00361 Chlorocyclohexane and chlorobenzene degradation
    MIP_00416
Enzymes [BR:mid01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     MIP_00416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AFS12292
UniProt: J9WCW6
Position
complement(321387..322142)
Genome map
AA seq 251 aa AA seqDB search
MTDYRSPSTGRVVRAVLFDTFGTVVDWRSGIAASVRRFAQRQHIDVDPDAFALEWRSRYL
PSMSEIRSGRREFVSLDVLHRENLVASLAKFGVSADALPCDEVQALARSWRWLPPWPDSV
DGIAVMKRHVIVGPLSNGNTGLLVEMAKYAGLPWDVVLGSDVSQAYKPDPRAYQTPARLL
GLEPGEVMLVAAHTADLEAARDSGLATGFVARPQEYGPDPVPAPAPPGPWDVSGTSLVEL
AGSLFGAQGRP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaccgactaccgctcaccgtcgaccggtcgggtagtgcgtgcagttctgttcgatacg
ttcggaacggtcgtcgactggcgctcggggatcgccgcctcggtacggcgtttcgcgcag
cgccaacacatcgacgtcgaccccgacgcgttcgcgctggagtggcgcagtcgatacctg
ccctccatgtccgagattcgctcgggccgacgggaattcgtgtcgctggacgttctgcat
cgagagaacctcgtcgcatcgctcgcgaagttcggcgtcagtgccgacgcgctgccctgc
gacgaggtgcaggcactcgcccggtcgtggcgctggctgccaccgtggccggacagcgtc
gacggcatcgcggtcatgaagcggcacgtcatcgtcgggcccttgtccaacggcaacacc
gggctgctggtcgagatggcgaagtacgcgggcctgccctgggatgtggtcctgggttcc
gacgtcagtcaggcctacaagcccgacccgcgggcctaccagactcccgcgcgattgctg
ggcctggagcccggtgaggtgatgctggtggcggcgcacaccgccgacctcgaggcggcc
cgcgatagcggcctggcgaccggtttcgtcgcgcgcccgcaggagtacgggccggacccg
gtgcccgcccccgcgcccccgggcccctgggacgtctcaggcacctcactggtcgaactg
gcgggctcactgttcggtgcgcagggccgaccttga

DBGET integrated database retrieval system