KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_00738Help
Entry
MIP_00738         CDS       T02325                                 

Definition
(GenBank) Putative glutamine amidotransferase
  KO
K07008  gamma-glutamyl hercynylcysteine S-oxide hydrolase [EC:3.5.1.118]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00340  Histidine metabolism
mid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    MIP_00738
Enzymes [BR:mid01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.118  gamma-glutamyl hercynylcysteine S-oxide hydrolase
     MIP_00738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_4
Motif
Other DBs
NCBI-ProteinID: AFS12500
UniProt: J9W6K7
Position
540613..541323
Genome map
AA seq 236 aa AA seqDB search
MCRHLGWLGADVTVSSLVLDPPFGLRVQAYAPRRQKHCLLNADGWGVGFFDAASDGAAPR
RWRSQLPLWGDVSFESVAPALRSHCVVAAVRSATVGMPIEVSATAPFTDGQWLLSHNGIV
DRAALPATSQAESVCDSAMLAAVIFERGLDALGDTIAEIAAADPRARLNILAANGSRMLA
TVWGDTLSILRRPDGVVLASEPYDNDSDWEDVPDRHLVEVTAGGVTMTPLDHPKGS
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggcatctggggtggctcggggccgacgtcacggtctcctcgctggtgctcgac
ccaccgttcgggctgcgggtgcaggcctacgcgccgcgccgccagaagcattgtctgttg
aacgcggacggctggggcgtcgggtttttcgatgctgcgtcggatggcgccgcgccccgg
cgctggcgcagccagctgccgctgtggggcgacgtgtccttcgagtccgtcgcgccggcg
ctgcgcagccactgcgtggtggccgcggtgcgctcggcgaccgtcggcatgccgatcgaa
gtcagcgcgaccgcgccgttcaccgacgggcaatggttgttgtcgcacaacggaatcgtc
gaccgggcggcgctgccggcgacgtcgcaggccgaatcggtctgcgacagcgcgatgctg
gcggccgtcatcttcgagcgcggcctcgatgcgctgggcgacaccatcgccgagatcgcg
gcggccgacccgcgcgcccggctgaacatattggccgccaacggttctcgcatgctggcg
acggtgtggggggacacgctgtccatcctgcgccgcccggatggtgtggtcctggccagc
gaaccctatgacaacgactccgactgggaggacgtgccggaccgccacctcgtcgaagtc
accgccggcggagtcacgatgaccccgctggatcatccgaaagggtcttga

DBGET integrated database retrieval system