KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_00990Help
Entry
MIP_00990         CDS       T02325                                 

Definition
(GenBank) Acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00360  Phenylalanine metabolism
mid00362  Benzoate degradation
mid00620  Pyruvate metabolism
mid00621  Dioxin degradation
mid00622  Xylene degradation
mid00650  Butanoate metabolism
mid01100  Metabolic pathways
mid01120  Microbial metabolism in diverse environments
mid01220  Degradation of aromatic compounds
Module
mid_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MIP_00990
   00650 Butanoate metabolism
    MIP_00990
  Amino acid metabolism
   00360 Phenylalanine metabolism
    MIP_00990
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MIP_00990
   00622 Xylene degradation
    MIP_00990
   00621 Dioxin degradation
    MIP_00990
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MIP_00990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFS12679
UniProt: J9W6K0
Position
710870..711784
Genome map
AA seq 304 aa AA seqDB search
MAIVGSGNISTDLLYKLLRSDWLEPRWMVGIDPESEGLARARKLGLETTHEGVDWLLAQS
DKPDLVFEATSAYVHRDAAPKYAAAGIRAVDLTPAAVGPAVIPPANLRQHLDAPNVNMIT
CGGQATIPIVYAVSRAVADLGGVPYAEIVASVASLSAGPGTRANIDEFTKTTSKGVETIG
GAKRGKAIIILNPADPPMIMRDTIFCAIPEDADRDAIAKSIHDVVAEVQTYVPGYRLLND
PQFDDPSINSGGQALVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKESLTATAG
GAQS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtggccattgtcgggtcgggcaacatcagcactgacctgctttacaagttgttgcgatcg
gactggctggagccgcgctggatggtcggcatcgaccccgaaagcgagggcctggcgcgg
gcccgcaagctgggtttggagaccacccacgagggcgtggactggttgctggcgcagtcg
gacaagcccgatctggtgttcgaggcgaccagcgcctacgtgcaccgcgacgccgcgccc
aagtacgcggccgccggcatccgggccgtcgacctgacgcccgccgcggtgggtcccgcg
gtgatcccgccggccaacctgcgccagcacctggatgcgcccaacgtcaacatgatcacc
tgcggcgggcaggccaccatcccgatcgtgtacgcggtgtcgcgcgccgtcgccgacctc
ggtggggtgccgtacgccgagatcgtcgcctcggtcgcctcgctgtcggcggggcccggc
acccgggccaacatcgacgagttcaccaagaccaccagcaagggcgtggagaccatcggt
ggcgccaagcgcggcaaggcgatcatcatcttgaaccccgccgatccgccgatgatcatg
cgcgacaccatcttttgcgccattcccgaggacgccgaccgcgacgcgatcgccaagtcc
atccacgacgtggtggccgaggtgcagacctacgttcccggctaccggctgctcaacgac
ccgcagttcgacgacccgtcgatcaactctggcggccaggcgctggtcaccacgttcgtc
gaggtcgagggggccggcgattacctgcccccctatgcgggcaacctggacatcatgacc
gccgcggcgaccaaggtcggcgaggagatcgccaaggaatccttgaccgcgacggccgga
ggagcgcaatcatga

DBGET integrated database retrieval system