KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_01689Help
Entry
MIP_01689         CDS       T02325                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00450  Selenocompound metabolism
mid00970  Aminoacyl-tRNA biosynthesis
mid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MIP_01689
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MIP_01689
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mid01007]
    MIP_01689
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mid03016]
    MIP_01689
Enzymes [BR:mid01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MIP_01689
Amino acid related enzymes [BR:mid01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MIP_01689
Transfer RNA biogenesis [BR:mid03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MIP_01689
 Prokaryotic type
   Other AARSs
    MIP_01689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AFS13165
UniProt: J9W879
Position
complement(1194412..1195956)
Genome map
AA seq 514 aa AA seqDB search
MRPYYVTTAITYPNGDPHIGHAYEYVATDAIARFKRLDGFDVRFLTGTDEHGLKMVETAA
AEGIGTAELARRNSDMFQRLQERLNISFDRFIRTTDPDHHEASKEIWRRMAAAGDIYLDT
YSGWYSVRDERFFVESETRLLDDGTRVAVETGAPVTWTEEQTYFFRLSAYADKLLAHYEA
NPDFIAPEVRRNEVVSFVAGGLRDLSISRTSFDWGVQVPEHPDHVMYVWVDALTNYLTGV
GYPDTDSEMFRRYWPADLHMIGKDIIRFHTVYWPAFLMSAGIELPRRVFAHGFLLNRGEK
MSKSVGNVVDPVALIEEFGVDQVRYFLLREVPFGQDGSFSEEAIITRINTDLANELGNLA
QRSLSMIAKNLGGVLPEPGEFTAADTELLATADGLLERLRASFESQAMHLALEAIWLMLG
EANRYFSAQQPWVLRKSESEADQQRFRTVLYVTCEAVRIAALLVQPVMPESAGTLLDLLG
QAQDQRTFAALGARLTPGTVLPPPTGVFPRYQND
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgtattacgtcaccaccgcaatcacctatccgaacggcgatccgcacatcggg
cacgcgtacgaatacgtcgcgaccgacgcgatcgcccggttcaagcggcttgacgggttc
gacgtgcggtttctgaccggcaccgacgagcacggcctcaagatggtggagacggcggcc
gccgagggcatcggcacggccgagctggcccgccgcaattcggatatgttccagcgcctg
caggagcggttgaacatctccttcgaccgcttcattcggaccactgaccccgaccaccac
gaggcgtccaaagagatctggcgccggatggccgccgccggcgacatctacctggacacc
tactcgggctggtactcggtgcgcgacgaacggtttttcgtcgaatcggaaaccagactc
ctcgacgacgggacccgggtggcggtggaaaccggcgccccggtgacctggaccgaggaa
cagacctacttcttccggctctcggcgtatgccgacaagctgctggcccactacgaggcg
aacccggacttcatcgcgcccgaggtgcgccgcaacgaggtcgtcagtttcgtggcgggc
ggcttgcgcgacctgtccatctcgcgcacctcgttcgactggggcgtgcaggtgcccgag
catcccgaccacgtgatgtacgtctgggtcgacgcgctgaccaactacctgaccggggtg
ggctacccggacaccgactcggagatgttccgccgctactggccggccgacctgcacatg
atcggcaaggacatcatccggtttcacaccgtgtactggccggcgtttctgatgtcggcc
ggaatcgagttgccgcgaagggttttcgcgcacggcttcctgctcaaccgcggcgagaag
atgagcaagtcggtgggcaacgtcgtcgacccggtcgccctgatcgaggagttcggcgtg
gaccaggtgcgttatttcctgttgcgggaggtcccgttcggccaggacggcagcttcagc
gaagaggccatcatcacccggatcaacaccgacctggccaacgaactgggcaacctggcc
cagcggtcgctgtcgatgatcgccaagaacctgggcggcgtgctgcccgaacccggtgag
ttcaccgccgccgacaccgaactgctggcgacggccgacggcctgttggagcggctgcgg
gccagcttcgaatcacaggcgatgcacctggcgctggaagcgatctggctgatgctcggc
gaggccaacagatacttttcggcgcagcagccgtgggtcttgcgcaagagcgagtcggag
gccgatcagcagcggttccgcacagtcttgtacgtcacctgcgaggcggttcgcatcgcg
gcgctgctggttcagcccgtcatgcccgaatcggccggcacgctgctcgatctgctgggg
caggcgcaagaccagcgaacatttgccgccctcggcgcgcggctgactcccggcacggtg
ctgccgcccccgacgggcgtgttcccccgctaccagaacgactag

DBGET integrated database retrieval system