KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_01824Help
Entry
MIP_01824         CDS       T02325                                 

Definition
(GenBank) Short chain dehydrogenase/reductase family 42E member 1
  KO
K16045  3beta-hydroxy-Delta5-steroid dehydrogenase / steroid Delta-isomerase [EC:1.1.1.145 5.3.3.1]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00984  Steroid degradation
mid01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MIP_01824
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.145  3beta-hydroxy-Delta5-steroid dehydrogenase
     MIP_01824
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.1  steroid Delta-isomerase
     MIP_01824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase NAD_binding_10 GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NmrA KR adh_short NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFS13253
UniProt: J9WAT0
Position
complement(1292097..1293197)
Genome map
AA seq 366 aa AA seqDB search
MISRMGDASLTAELGRVLVTGGSGFVGANLVTTLLDRGHQVRSFDRAPSPLPEHPQLEVL
QGDITDTAVCARAVDGIDTVFHTAAIIDLMGGASVTEEYRQRSFGVNVGGTENLVRAGQA
AGVQRFVYTSSNSVVMGGQNIAGGDETLPYTDRFNDLYTETKVIAERFVLGQNNVDGLLT
CAIRPSGIWGRGDQTMFRKLFESVIAGHVKVLIGRKSARLDNSYVHNLIHGFILAAQHLV
PGGTAPGQAYFINDAEPINMFEFARPVIEACGENWPRVRVNGPVVRAAMTGWQRLHFRFG
IPAPLLEPLAVERLYLDNFFSIAKASRDLGYQPLFTTEQALSECLPYYVGMFEQMKRDAL
TAKVSG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgcgcatgggtgatgcatctctgacggccgagctcggccgcgtcctggtcacc
ggggggtccggattcgtcggcgccaacctggtgaccaccctgctcgaccgcgggcatcag
gtccgctcgtttgaccgcgccccttcgccgctaccggagcatccccagttggaggtgctg
cagggagacatcaccgacacggccgtgtgcgcccgagcggtcgacggcatcgacacggtg
tttcacaccgcggcgatcatcgacctgatgggcggcgcgtcggtgaccgaggagtaccgc
cagcgcagcttcggggtcaacgtcgggggcaccgagaacctggtccgcgccgggcaggcg
gccggggtgcagcgcttcgtctacacctcgtcgaacagtgtcgtgatgggcggccagaac
atcgcgggcggcgacgagacgctgccctacaccgaccggttcaacgatctgtacaccgag
accaaagtgatcgccgagcgatttgtattgggccagaacaatgttgacggcctactgacg
tgtgcgatccggcccagcggcatctggggccgcggcgaccagacgatgttccgcaagctg
ttcgagagcgtgatcgccggtcacgtcaaggtgttgatcggccgcaaatcggccaggttg
gacaactcctacgtgcacaacctgattcacggtttcatcttggcggcccagcatctggta
cccggcggcaccgcacccggtcaggcgtacttcatcaacgacgccgagccgatcaacatg
ttcgagttcgcgcggccggtgatcgaggcctgcggcgagaattggccccgcgtccgggtg
aacggccccgtcgtgcgcgcggcgatgacgggttggcaacggctgcatttccggtttggg
ataccggcgccgctgctcgagccactggccgtcgagcggctgtacctggacaacttcttc
tcgatcgccaaagcgtctcgtgacctcggctatcaaccgctgttcaccacggagcaggcg
ctgtcggaatgtctgccgtactacgtgggcatgttcgagcagatgaagcgagacgcgttg
acggccaaggtatccggttag

DBGET integrated database retrieval system