KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_03551Help
Entry
MIP_03551         CDS       T02325                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00030  Pentose phosphate pathway
mid00480  Glutathione metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
Module
mid_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mid_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MIP_03551
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MIP_03551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mid04147]
    MIP_03551
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     MIP_03551
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     MIP_03551
Exosome [BR:mid04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   MIP_03551
  Exosomal proteins of colorectal cancer cells
   MIP_03551
  Exosomal proteins of bladder cancer cells
   MIP_03551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N AflR
Motif
Other DBs
NCBI-ProteinID: AFS14438
UniProt: J9WE72
Position
complement(2623067..2624566)
Genome map
AA seq 499 aa AA seqDB search
MATAKPQTISYPAPDARPRRHHPDPLDPHVIVLFGATGDLAKRKLIPGLAYLDQSELAPN
IQIVATSLEDLTDDEFRELAKNAIDSFGTHKLTPDQWANFARIMTYVPQGAGPEALATAV
ADAEANLGPNARRLHYLSVPPKAARAVITMLRDAKLVDRSRVVMEKPFGTDLASAVALND
FVHETFEESQIFRIDHFLGKEAAQNILAFRFANGLFEPIWNRNFIDHIQIDIPEALGLDQ
RASFYEETGAYKDMVVTHLFQVMAFVVMEPPTALEPFAISEEKNKVFRSMLPVKPSNVVR
GQYQGYRDEAGVARDSDTETFIALRVGIDNWRWAGVPIYLRTGKKMAEGIRIISIAFKEA
PRTMFPPGSGVGTQGPDHLTFDLADNSKVSLSFYGKRPGPGMKLDKLSMQFSSQEIETVV
DVLEAYERLILDAMRGDHTLFNTAEGIESLWERSEELLTDPPAVKLYQPGSWGPNAIHQL
IAPNAWRLPFEREWRDARP
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
gtggccaccgcaaaacctcagaccatctcgtaccccgcgcccgacgcacgcccgcgtcgc
caccaccccgatccgttggacccccacgtcatcgtcctgttcggcgcgacgggggatctg
gccaagcgaaagctcatccccggcctggcctacttggaccagtccgagctggcgcccaac
attcagatcgtcgccacctcactggaagacttgaccgacgacgaatttcgcgagctcgcc
aagaacgcgatcgattcattcgggacacacaagctcacacccgaccaatgggcgaacttc
gcgaggatcatgacctacgtcccgcagggcgccggacccgaagcgctggccaccgccgtg
gcggacgccgaagccaacctgggccccaacgcccggcggctgcattacctgtcggtgccg
cccaaggcggcgcgcgcggtgatcaccatgctgcgcgacgcgaaattggtcgaccgctca
cgggtcgtgatggagaaaccattcggcaccgatctggccagcgcggtggcgctcaacgac
ttcgtgcacgaaaccttcgaggaatcccagattttccgcatcgaccacttcttgggcaaa
gaggccgcccagaacatcttggcgttccgcttcgccaatggtctgttcgaaccgatctgg
aaccgcaacttcatcgaccacatccaaatcgatatccccgaggcactgggcctggatcaa
cgggcgagcttctacgaagaaaccggcgcatacaaggacatggtggtcacccacttgttc
caagtgatggcgttcgtggtgatggagccgccgacggcgctcgaaccctttgccatcagc
gaagagaagaacaaggtgttccggtcgatgctgccggtcaagccctcgaatgtggtgcgc
ggccagtaccaggggtaccgcgacgaagccggggtggcaagggattccgacaccgagacg
ttcatcgccctccgggtcggcatcgacaactggaggtgggccggggtgcccatctacctg
cggaccggcaagaagatggccgagggcatccgcatcatctccatcgcgttcaaggaggcc
ccgcgcacgatgttcccacccggatccggggtgggaacccaagggcccgatcacctcacg
ttcgacctcgccgacaactcgaaggtgtctttgtcgttctatggcaagcggcccggcccc
ggcatgaagctggacaagctgtccatgcaattctcctcgcaggagatcgagacggtggtc
gatgtgctggaggcctacgaacggctcatcctcgacgcgatgcgcggcgaccacaccctg
ttcaataccgcggaaggcatcgaatccttgtgggagcgttcggaagagctcctcaccgat
ccacccgcggtcaagctgtaccagccggggtcctgggggcccaacgccattcaccagttg
atcgcgcccaacgcctggcggttgccgttcgagcgggagtggcgcgacgccaggccctga

DBGET integrated database retrieval system