KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_03936Help
Entry
MIP_03936         CDS       T02325                                 

Definition
(GenBank) Malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00620  Pyruvate metabolism
mid00630  Glyoxylate and dicarboxylate metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01200  Carbon metabolism
Module
mid_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MIP_03936
   00630 Glyoxylate and dicarboxylate metabolism
    MIP_03936
Enzymes [BR:mid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     MIP_03936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase Herpes_UL79
Motif
Other DBs
NCBI-ProteinID: AFS14698
UniProt: J9WEU8
Position
complement(2888987..2891140)
Genome map
AA seq 717 aa AA seqDB search
MLYDFVNEEALPGTDIDPDSFWAGVDKVVTDLTPKNQDLLRRRDELQAQIDKWHRQRVIE
PLDIDAYREFLTEIGYLLPEPADFTITTSGVDDEITTTAGPQLVVPVLNARFALNAANAR
WGSLYDALYGTDVISEDDGAEKGSSYNKVRGDKVIAYARKFLDEAVPLESGSWADATGLS
VEDGRLKVATADGSAGLADPDKFAGYTGELGSPSWSVLLVNHGLHIEILIDPDSPIGKTD
AAGIKDVILESAVTTIMDFEDSVAAVDADDKVLGYRNWLGLNKGDLSEDVDKDGKTFTRV
LNQDRTYSTPDGEGELTLPGRSLLFVRNVGHLMTNDAIVDAEGHEVFEGIMDALFTGLTA
IHGLKTSEANGPLANSRTGSIYIVKPKMHGPDEVAFTCELFSRVEDVLGLPQGTLKVGIM
DEERRTTVNLKACIKAAADRVVFINTGFLDRTGDEIHTSMEAGPMIRKGAMKSTTWIKAY
EDANVDIGLAAGFKGKAQIGKGMWAMTELMADMVEQKIGQPKAGATTAWVPSPTAATLHA
MHYHYVDVGAVQEELAGKKRTNIDELLTIPLAKELAWAPEEIREEVDNNCQSILGYVVRW
VAQGVGCSKVPDIHDVALMEDRATLRISSQLLANWLRHGVITEEDVRASLERMAPLVDEQ
NAKDAAYLPMAPNFDDSLAFLAAQDLILTGTQQPNGYTEPILHRRRREAKARAAQSN
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
gtgctttacgacttcgtgaacgaagaggccttgcccggcaccgatatcgacccggacagc
ttctgggccggcgtggacaaggtcgtcaccgacctcaccccgaagaaccaggatctgctg
cgccggcgtgacgagctgcaggcccagatcgacaagtggcaccggcagcgggtcatcgag
ccgctcgacatcgacgcctaccgcgagttcctcaccgaaatcggttacctgctgcccgaa
cccgcggatttcacgatcaccacctcgggcgtcgacgacgagatcaccacgaccgcgggc
ccccagctcgtggtgccggtactcaacgcccggttcgcgctgaacgccgccaacgcccgg
tggggttcgctctacgacgccctgtacggcaccgacgtcatctcggaggacgacggcgcc
gaaaaggggtcgagctacaacaaggtgcgtggcgacaaggtcatcgcctacgcgcgcaaa
ttcctggacgaggccgtgccgctggagtccggctcgtgggccgacgcgaccggtctgtcc
gtcgaggacggccgcctgaaggtcgcgaccgccgacggctccgccggcctggccgacccg
gacaagttcgccggctacaccggcgagctcggctcccccagctggtcggtgctgctggtc
aaccacggcctgcacatcgagatcctcatcgatccggactcgccgatcggcaagaccgac
gccgccggcatcaaggacgtgatcctggaatcggccgtgaccacgatcatggacttcgag
gactcggtggccgccgtcgacgccgacgacaaggtgctcggctaccgcaactggctcggc
ctgaacaagggcgacctgtccgaggacgtcgacaaggacggcaagaccttcacccgggtg
ctcaaccaggaccgcacctactccacgcccgacggcgagggcgagctgaccctgccgggc
cgcagcctgctgttcgtccgcaacgtcggccacctgatgaccaacgacgcgattgtcgac
gcggagggtcacgaggtgttcgagggcatcatggacgcgctgttcaccgggctgaccgcg
attcacgggctcaagacgagtgaggcgaacgggccgctggccaacagccgcaccgggtcc
atctacatcgtcaagcccaagatgcacgggcccgacgaggtcgcgttcacctgcgagctg
ttcagccgggtcgaagacgtcctcgggctgccgcagggcaccctcaaggtcggcatcatg
gacgaggagcggcgcaccaccgtcaacctcaaggcctgcatcaaggccgcggccgaccgg
gtggtgttcatcaacaccggcttcctggaccgcaccggcgacgagatccacacctcgatg
gaggcgggtccgatgatccgcaagggcgcgatgaagagcaccacctggatcaaggcctac
gaggacgccaacgtcgacatcggcctggccgccgggttcaagggcaaggcgcagatcggc
aagggcatgtgggcgatgaccgaactgatggccgacatggtcgagcagaagatcggccag
cccaaggccggagcgaccaccgcgtgggtgccctcgccgacggcggccaccctgcacgcg
atgcactaccactacgtcgacgtgggcgccgtgcaggaggagctggcgggcaagaagcgc
accaacatcgacgagttgctgaccatcccgctggccaaggaactcgcctgggctcccgag
gagatccgcgaggaggtcgacaacaactgccagtccatcctcggctacgtggtgcgctgg
gtcgcccagggcgtgggatgctccaaggtgcccgacatccacgacgtggcgctcatggaa
gaccgtgcgacgctgcggatttcgagtcagctgctggcgaactggctgcgccacggtgtg
atcaccgaggaggacgtgcgcgccagcctcgagcggatggccccgctggtggacgagcaa
aacgccaaggatgcggcgtatttgccgatggcgcccaacttcgacgacagcctggcgttc
ctggcggcgcaggacctcatcctgaccggaacgcagcagcccaacggctacaccgagccg
atcctgcaccgccgtcggcgcgaggccaaggcgcgcgccgcgcagtcgaattga

DBGET integrated database retrieval system