KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_03985Help
Entry
MIP_03985         CDS       T02325                                 

Definition
(GenBank) acetyl-CoA acetyl transferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00071  Fatty acid degradation
mid00072  Synthesis and degradation of ketone bodies
mid00280  Valine, leucine and isoleucine degradation
mid00310  Lysine degradation
mid00362  Benzoate degradation
mid00380  Tryptophan metabolism
mid00620  Pyruvate metabolism
mid00630  Glyoxylate and dicarboxylate metabolism
mid00640  Propanoate metabolism
mid00650  Butanoate metabolism
mid00900  Terpenoid backbone biosynthesis
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01200  Carbon metabolism
mid01212  Fatty acid metabolism
mid02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MIP_03985
   00630 Glyoxylate and dicarboxylate metabolism
    MIP_03985
   00640 Propanoate metabolism
    MIP_03985
   00650 Butanoate metabolism
    MIP_03985
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MIP_03985
   00072 Synthesis and degradation of ketone bodies
    MIP_03985
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MIP_03985
   00310 Lysine degradation
    MIP_03985
   00380 Tryptophan metabolism
    MIP_03985
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MIP_03985
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MIP_03985
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MIP_03985
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mid04147]
    MIP_03985
Enzymes [BR:mid01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MIP_03985
Exosome [BR:mid04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MIP_03985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFS14729
UniProt: J9WBW6
Position
2921188..2922672
Genome map
AA seq 494 aa AA seqDB search
MTVDPRTPVLIGYGQVNHRDEIDPATRSVEPMDLMVAAVERAADAAVIEAVDSIRVVNIL
SAQYRDPGLLLGQRIGASDFTTLYSPVGGNVPQSLLSQACLDIQGGRAGVVLLAGAETWR
TRRGLRAQGGKLVWTEQDRSVPMAEVSGDDVPMAGDAEIRISLDRPAYVYPLFEQALRVA
RGESIDDHLQRIGELWARFNAVAVDNPHAWIRTPSSADDIRRVGPRNRMISWPYTKLMNS
NNMVDQGAALVLTSVEQARRLKIPAERWVYPHAGTDAHDTPSIAERHELHRSTAIRIAGA
RTLELAGLGIDDIDYVDLYSCFPSAVQVAAAELGLSVDDPARPLTVTGGLTFAGGPWSNY
VMHSIATMAELLVANPGRRGLITANGGYLTKHSFGVYGTEPPAEFRWEDTQPEVDAEPTT
DAMVEWEGVGTLEAWTTPYDREGRPEKAFLAVRTPDGSRALAVVTDADAVQASVREDLGG
AKVAVAADGSATLR
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgaccccaggaccccggttttgatcggctatggccaggtcaaccatcgcgac
gagatcgatccggccacccggtccgtcgaaccgatggacctgatggtggccgcggtcgag
cgggccgccgacgccgcggtgatcgaggcggtcgactcgatccgggtggtcaacatcctg
tcggcccagtatcgcgatcccgggctgttattgggccagcgcatcggcgcctcggatttc
accacgctgtacagcccggtcggcggcaatgtgccgcagtcgctgctcagccaggcctgc
ctggacatccagggcggccgcgcgggcgtcgtgctgctggccggcgccgaaacctggcgc
accaggcggggtctgcgggcccagggcggcaagctggtgtggaccgaacaggaccgctcg
gtcccgatggccgaggtgagcggcgacgacgtcccgatggccggcgacgccgagatcagg
atttccctggaccgcccggcctacgtctaccccttgttcgagcaggcgctgcgggtggcg
cgcggcgagtcgatcgacgatcacctccagcgcatcggggagctgtgggcgcggttcaac
gcggtggcggtggacaacccgcacgcgtggatccgcacgccgtccagtgccgacgacatc
cgccgggtgggcccgcggaaccggatgatcagctggccctacaccaagttgatgaactcc
aacaacatggtcgaccagggcgcggcgctcgttctgacctcggtcgagcaggccaggagg
ctgaagatccccgccgaacgctgggtgtacccgcacgcgggcaccgacgcgcacgacaca
ccgtccatcgccgagcgccacgaactgcaccggtccacggccatccggatcgccggcgcg
cggacgctcgagctggccggcctgggcatcgacgacatcgattacgtcgacctgtactca
tgctttccctccgcagtgcaagtggcggcggccgaactcgggctgagcgtcgacgacccc
gcccggccgctgaccgtgaccggcggactgacgttcgccggcggcccgtggagcaactac
gtgatgcattcgatagccaccatggcggagttgctggtggccaatccgggccggcgcggt
ctgatcaccgccaacggcggctacctgaccaaacacagcttcggtgtctacggcaccgaa
ccgccggccgaattccgttgggaggacacccaaccagaggtcgacgcggagccgacgacc
gacgcgatggtggaatgggaaggcgtgggcaccctcgaggcgtggacgacgccgtatgac
cgcgagggacggccggaaaaggcctttctggcggtgcgcacccccgacgggtcgcgcgcg
ctggccgtggtcaccgacgccgacgcggtgcaggcctcggtgcgtgaagatctcggtggc
gccaaggtcgccgtcgccgcggacggcagcgcgacgctgcggtag

DBGET integrated database retrieval system