KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_05294Help
Entry
MIP_05294         CDS       T02325                                 

Definition
(GenBank) putative enoyl-CoA hydratase paaF
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00071  Fatty acid degradation
mid00280  Valine, leucine and isoleucine degradation
mid00281  Geraniol degradation
mid00310  Lysine degradation
mid00360  Phenylalanine metabolism
mid00362  Benzoate degradation
mid00380  Tryptophan metabolism
mid00410  beta-Alanine metabolism
mid00627  Aminobenzoate degradation
mid00640  Propanoate metabolism
mid00650  Butanoate metabolism
mid00903  Limonene and pinene degradation
mid00930  Caprolactam degradation
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01212  Fatty acid metabolism
Module
mid_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MIP_05294
   00650 Butanoate metabolism
    MIP_05294
  Lipid metabolism
   00071 Fatty acid degradation
    MIP_05294
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MIP_05294
   00310 Lysine degradation
    MIP_05294
   00360 Phenylalanine metabolism
    MIP_05294
   00380 Tryptophan metabolism
    MIP_05294
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MIP_05294
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MIP_05294
   00281 Geraniol degradation
    MIP_05294
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MIP_05294
   00627 Aminobenzoate degradation
    MIP_05294
   00930 Caprolactam degradation
    MIP_05294
Enzymes [BR:mid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MIP_05294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AFS15567
UniProt: J9WLV6
Position
3890345..3891094
Genome map
AA seq 249 aa AA seqDB search
MTDEILLIDTEERVRTLTLNRPQSRNALSSALRDRFFGALADAETDDDVDVVIVTGADPV
FCAGLDLKELGGSSALPDISPRWPAMTKPVIGAINGAAVTGGLELALYCDILIASENARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSMTGDYLSAADALRAGLVTEVVPHERLLG
AARQVAASIVGNNQDAVRALLASYHRIDDAQTGAGLWQEAMAARQFRTSGDDIAANREAV
LQRGRAQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgagatcctgctgatcgacaccgaggaacgggtccgcaccctgaccctgaac
cgaccccaatcgcgcaacgcgctgtcctcggcgttgcgggaccgcttcttcggcgcgctg
gccgacgccgaaaccgacgacgacgtcgacgtcgtcatcgtcaccggcgccgacccggtg
ttctgcgcgggactcgatctcaaggagctcggcggctcgtcggcgctgccggacatctcg
ccgcggtggccggcgatgaccaagccggtgatcggcgccatcaacggcgccgccgtgacc
ggcgggctggagctggcgctgtactgcgacatcctgatcgcctcggagaacgcccgcttc
gccgacacgcacgcccgggtgggcctgctgcccacctgggggctgagcgtgcggttaccg
cagaaggtgggcatcggcctggcccggcggatgagcatgaccggcgactacctgtccgcc
gccgacgcgctgcgcgccggcctggtgaccgaggtggtgccccacgagcggctgctgggt
gccgcgcgccaggtcgccgcgtcgatcgtggggaacaaccaggacgcggtgcgggcgctg
ctggcgtcctatcaccgcatcgacgacgcgcagaccggcgcggggctctggcaggaggcg
atggcggcccggcaattccggaccagcggcgacgacatcgccgccaaccgcgaggccgtg
ctgcaacgcgggcgggcccaggtccgctga

DBGET integrated database retrieval system