KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_05989Help
Entry
MIP_05989         CDS       T02325                                 

Definition
(GenBank) Vitamin B12 transport periplasmic protein btuE
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00480  Glutathione metabolism
mid00590  Arachidonic acid metabolism
mid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    MIP_05989
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MIP_05989
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MIP_05989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AFS16033
UniProt: J9WIP7
Position
4347977..4348465
Genome map
AA seq 162 aa AA seqDB search
MTLKDIALNTLDGRPTTLAELSDGATLVVNVASKCGLTPQYTALEKLAKDYRDRGLTVVG
VPCNQFMGQEPGTADEIQEFCSTTYGVTFPLLAKTDVNGDGRHPLYAELTKAADADGQAG
DIQWNFEKFLLAPDGAVVQRFRPRTEPDAPEVISAIEAVLPR
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcaaagacatcgccctgaacaccctcgacggccggcccaccacgctggccgaa
ttgtccgacggcgcaacgctcgtcgtcaacgtggcctccaaatgcgggctcactccgcag
tacacggcgctcgagaagctggccaaggactaccgcgaccgcggcctgaccgtcgtcggc
gtcccctgtaaccagttcatgggacaggaacccggcacggccgacgagatccaggagttc
tgctcgaccacctacggggtgacgttcccgttgttggcgaagaccgacgtcaacggcgac
ggccgccacccgctgtacgccgagttgaccaaagccgccgacgccgacggccaggcggga
gacatccagtggaacttcgagaagttcctcctcgcacccgacggtgcggtggtgcagcgc
ttccggccccgcaccgagcccgacgcccccgaggtcatcagcgccatcgaggccgtgctg
ccgcggtag

DBGET integrated database retrieval system