KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_06271Help
Entry
MIP_06271         CDS       T02325                                 

Definition
(GenBank) Cytidine deaminase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00240  Pyrimidine metabolism
mid00983  Drug metabolism - other enzymes
mid01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MIP_06271
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    MIP_06271
Enzymes [BR:mid01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MIP_06271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N DUF3375
Motif
Other DBs
NCBI-ProteinID: AFS16219
UniProt: J9WG15
Position
complement(4542671..4543954)
Genome map
AA seq 427 aa AA seqDB search
MPPAFDAPTVIRTKRDGGRLSDAAIDWVVDAYTAGRVAEEQMAALLMAILLRGMDRGETA
RWTSAMLASGERLDFSDLGVPTVDKHSTGGVGDKITLPLVPVVAACGAAVPQASGRGLGH
TGGTLDKLESIAGFTAALSNRRVRDQLRDLGAAIFAAGDLAPADAKLYALRDITATVESL
PLIASSVMSKKLAEGAGALVLDVKVGSGAFTDSEAQSRDLASAMVALGAAHGVPTRALLT
DMNTPLGATVGNALEVAESLEVLAGGGPPDVVELTLRLASEMLELAGVDGRDPAETLRDG
TAMDRFRQLVAAQGGDLSVPLPIARHAETVTATRGGTMGDIDAMAVGLAAWRLGAGRSRP
GDRVQFGAGIRLHRRPGEPVTAGEPLFTLYTDTPGRFGAALAELDGAFGVGDAAPASRPL
IIDRIAQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgccttcgacgcgcccacggtgatcaggaccaagcgcgacggcggccggttg
tccgacgccgccatcgactgggtcgtcgacgcctacaccgccggccgggtggccgaggag
cagatggcggccctgctgatggcgatcctgttgcggggcatggatcgcggcgagacggcc
cggtggacgtcggcgatgctggcctcgggcgagcggctcgacttcagcgacctcggcgtg
cccacggtcgacaagcactccaccggcggggtgggggacaagatcaccctgcccctggtg
cccgtcgtcgccgcgtgcggcgccgcggtgccgcaggcgtcgggccgcgggctcggccac
accggcggcacgctggacaagctggaatccatcgccggattcaccgccgcgctgtccaac
cggcgggtgcgcgaccaactgcgcgacctcggcgcggccatcttcgccgccggtgacctg
gccccggccgacgccaagctgtacgcgctgcgcgacatcaccgccaccgtcgagtcgctg
ccgctgatcgcgagctcggtgatgagcaagaagctggccgagggggccggcgcgctggtg
ctcgacgtgaaggtcggttccggggcgttcaccgactcggaagcgcagtcccgcgacctg
gcgagcgccatggtcgcgctgggcgccgcgcacggggtgcccacccgcgcgctgctgacg
gacatgaacaccccgctgggcgcgaccgtcggcaacgccctcgaggtcgccgagtcgctc
gaggtgctggccgggggcgggccgcccgacgtcgtcgagctgacgctgcggctggcctcc
gagatgctcgagctggccggggtcgacggccgcgatcccgccgagacactgcgggatggc
accgcgatggaccggtttcgccagctcgtcgccgcccagggcggcgatttgtcggtgccg
ctgccgatcgctcggcatgccgagaccgtgaccgccacccggggcggcacaatgggcgat
atcgacgcgatggcagtggggctggcggcttggcggctcggagcgggcagatcccgtccg
ggcgatcgcgtgcagttcggcgccggcatccggctgcatcgccgccccggcgagccggtc
acggccggtgagccgctgttcaccctgtacaccgacaccccggggcgcttcggcgcggcg
ctcgccgagctggacggcgccttcggcgtcggcgacgccgccccagcttcgcgtccgctg
atcatcgatcggatcgcgcaatga

DBGET integrated database retrieval system