KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_06364Help
Entry
MIP_06364         CDS       T02325                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00984  Steroid degradation
mid01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    MIP_06364
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     MIP_06364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C DAO GMC_oxred_N FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Pyr_redox HI0933_like
Motif
Other DBs
NCBI-ProteinID: AFS16277
UniProt: J9WNK8
Position
complement(4608861..4610597)
Genome map
AA seq 578 aa AA seqDB search
MKPDYDVLIIGSGFGGSVSALRLTEKGYRVGVLEAGRRFADEDFAETSWDLRKFLWAPKL
GCYGIQRIHPLRNVLILAGAGVGGGSLNYANTLYVPPEPFFKDQQWSHITDWRDELMPHY
DQARRMLGVVENPTFTDADRVVKEVADDMGCGDTFVPTPVGVFFGPDGTKAPGKTVPDPY
FGGAGPERTGCLECGCCMTGCRYGAKNTLLKNYLYLAESGGAQVIPMTTVKRFEQRPDGL
WEVRTVRTGSWLRRDRRTYTAKHLILAAGTWGTQHLLFKMRDEGRLPRLSNRLGVLTRTN
SESIVGAGRLEVSPDLDLTHGVAITSSIHPTPDTHIEPVRYGKGSNAMGLLQTLMTDGPG
PEGTDVPRWKQLLDTAREDPRGMLRLLNPRQWSERTMIALVMQHLDNSITTFTKRGKLGI
RWYTSKQGHGEPNPTWIPVGNEVTRRIAAKIDGVAGGTWGELLNIPLTAHFLGGAVIGDN
ADHGVIDPYHRVYGYPTLYVVDGAAISANLGVNPSLSITAQAERAASLWPNNGENDRRPA
QGEPYRRLDPIAPAHPRVPLSAPGALRWSPVDPVSSVG
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atgaagccggattacgacgtactgatcatcggttcgggttttgggggcagcgtcagcgca
ttgcggctgacggaaaagggctaccgcgtcggcgtcctcgaggccggacgccggttcgcc
gacgaggatttcgcggagacgtcctgggatctgcgcaagttcctgtgggcgccgaagctg
ggttgctacggcatccagcgcatccacccgctacgcaacgtgctgatcctggccggcgcc
ggcgtgggcggcggctcgctgaactacgccaacacgctgtatgtgccgccggagccgttc
ttcaaagaccagcagtggtcgcacatcaccgactggcgcgacgagctgatgccgcactac
gaccaggcgcgacgcatgctgggcgtggtggaaaacccgaccttcaccgacgccgatcgc
gtcgtcaaggaggtcgccgacgacatgggctgcggcgacacgttcgtgccgacgccggtc
ggggtgttcttcggccccgacggcaccaaggcgccgggcaagaccgtgccggacccctac
ttcggcggcgccggacccgagcgcaccggctgcctggagtgcggctgctgcatgaccggg
tgccgctacggcgccaagaacaccctgctgaagaactacctctatctcgcggaatcgggt
ggggcgcaagtcattccgatgacgaccgtgaagcggttcgagcagcgccccgacgggctg
tgggaggtccgcacggtgcgcaccggcagttggctgcgccgcgaccggcgcacctacacc
gccaagcacctgatcctggccgccgggacgtggggcacccagcacctgctgttcaagatg
cgcgacgagggccggctgccccggctctccaaccgcctcggcgtgctgacccgcaccaac
tccgagtccatcgtcggggccgggcgcctggaggtctctccggatctggacctcacccac
ggggtggcgatcacgtcgtcgatccacccgacgcccgacacccacatcgagccggtccgc
tacggcaagggctccaacgcgatggggctgctgcagacgttgatgaccgacgggccgggc
cccgaaggcaccgacgtgccacgctggaagcagttgctggacaccgcccgtgaagatccg
cgcggaatgctgcggctgctcaacccgcgccagtggagtgagcgcaccatgatcgcgctg
gtgatgcagcacctggacaactcgatcaccacgttcaccaaacgcggcaagctcggcatc
cgctggtacaccagcaagcagggccacggcgagccgaacccgacgtggatcccggtgggc
aacgaggtcacccgccgcatcgccgccaagatcgacggcgtggcgggcggcacctggggc
gagctgctcaacatcccgctgaccgcgcacttcctcggcggcgcggtgatcggcgacaac
gccgaccacggggtcatcgacccctatcaccgggtctacggctacccgacgctgtatgtg
gtggacggcgcggcgatctcggcgaacctgggcgtgaatccgtcgctgtccatcaccgcc
caggccgagcgggccgcgtcgctgtggccgaacaacggcgaaaacgaccggcgcccggcg
cagggcgagccgtatcgccggctggatccgatagcgccggcgcacccgcgggtgcccctc
tccgccccgggcgcgctgcgctggtcaccggtcgatccggtcagctcggtgggctag

DBGET integrated database retrieval system