KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_06456Help
Entry
MIP_06456         CDS       T02325                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00521  Streptomycin biosynthesis
mid00523  Polyketide sugar unit biosynthesis
mid01130  Biosynthesis of antibiotics
Module
mid_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MIP_06456
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MIP_06456
Enzymes [BR:mid01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MIP_06456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: AFS16340
UniProt: J9WH54
Position
4667273..4667902
Genome map
AA seq 209 aa AA seqDB search
MGSDVEVRELKVPGAWEITPAVHGDSRGHFFEWLTDKGFRSFAGHRLDVRQANCSVSSAG
VLRGLHFAQVPPSQAKYVTCVRGAVFDVVVDIRVGSPTFGQWDSVLLDDTEHRTIYLSEG
LGHGFLALQDNSTVMYLCSAEYNPQREHTICATDPALGIDWPLVDGAPPTLSDRDAAAPS
LDDVRASGLLPTWEETNAFVEGLRAKPTN
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
gtgggcagtgacgtggaagttcgcgagctgaaagttcccggcgcctgggagatcaccccc
gccgttcatggcgattcgcggggtcatttcttcgaatggctgaccgacaagggattcagg
tccttcgccggtcaccggttggatgttcggcaggccaattgctcggtgtcatcggccggc
gtgctgcgcggcctgcacttcgcccaggtaccgccgagccaggccaagtacgtgacctgc
gtgcgcggggcggtattcgacgtcgtcgtcgacatccgggtgggctcaccgacattcggt
cagtgggactcggtgctgctcgacgacaccgagcacaggacgatctacctctccgagggc
ctcggacacggtttcctggcgctgcaagacaattcgacggtgatgtacttgtgctcggcg
gaatacaacccgcaacgcgaacacaccatttgcgcaaccgatccggcgctggggatcgat
tggccgctggtggacggcgcgccgcccaccctgtccgaccgcgacgcggcggcccccagc
ctcgacgacgtacgcgcctccggcctactccccacgtgggaggagacgaacgcgttcgtc
gagggtttgcgggcaaagcccacgaattga

DBGET integrated database retrieval system