KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_07212Help
Entry
MIP_07212         CDS       T02325                                 

Definition
(GenBank) Trans-aconitate 2-methyl transferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Brite
KEGG Orthology (KO) [BR:mid00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MIP_07212
Enzymes [BR:mid01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     MIP_07212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_12 Methyltransf_31 MTS FtsJ Methyltransf_2 MetW Methyltransf_32
Motif
Other DBs
NCBI-ProteinID: AFS16850
UniProt: J9WIK7
Position
complement(5176150..5176929)
Genome map
AA seq 259 aa AA seqDB search
MWDPDVYLAFADHRGRPFYDLLSRVGAERARRVVDLGCGPGHLTTYLGRRWPDAVIEAMD
SSPEMVAAAKERGIDAVTGDLRDWKPQPDTDVVVSNAALHWVPEHADLLLRWAGELAPGS
WIGVQMPGNFESPSYAAVRALARREPYAKLLRDIPFRVGAVVQPPAHYANLLLDAGCRVD
VWETTYLHQLTGEHPVLEWITGTALVPVRERLDDDTWQQFREELIPLLSDAYPARSDGST
IFPFRRVFVVAVVGGAGRA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgtgggacccggacgtctacctggcctttgccgatcaccgcggccggcccttctacgat
ctgctgtcgcgggtgggcgccgagcgggcgcgccgcgtcgtcgatctcggttgcgggccc
ggacacctgacgacatacctgggccggcgctggccggacgcggtgatcgaggcgatggac
agctccccggagatggtggccgccgccaaggagcgcggcatcgacgccgtcaccggcgac
ctgcgcgactggaagccccagcccgacaccgacgtggtggtcagcaacgcggccctgcac
tgggtgcccgagcatgccgacctgttgctgcggtgggcgggcgagctggcgcccggatcg
tggatcggggtgcagatgccgggcaacttcgagtccccgtcctacgcggcggtgcgggcg
ctggcccgccgtgagccgtatgcgaagttgttgcgcgacataccgtttcgcgtcggtgcg
gtggtgcagccgcccgcgcactatgccaacctgctgctggacgcgggatgccgggtcgac
gtctgggagaccacgtatctgcatcagctgaccggcgagcatccggtgctggagtggatc
accggcacggcgctggtcccggtgcgcgagcggctcgacgacgacacctggcagcagttc
cgcgaggagttgattccgctgctgtccgacgcctatccggcgcgctcagacggctcgacg
atcttcccgttccggcgggtcttcgtcgtcgccgtggtgggcggcgcgggccgcgcgtag

DBGET integrated database retrieval system