KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_07373Help
Entry
MIP_07373         CDS       T02325                                 

Definition
(GenBank) Carnitinyl-CoA dehydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00071  Fatty acid degradation
mid00280  Valine, leucine and isoleucine degradation
mid00281  Geraniol degradation
mid00310  Lysine degradation
mid00360  Phenylalanine metabolism
mid00362  Benzoate degradation
mid00380  Tryptophan metabolism
mid00410  beta-Alanine metabolism
mid00627  Aminobenzoate degradation
mid00640  Propanoate metabolism
mid00650  Butanoate metabolism
mid00903  Limonene and pinene degradation
mid00930  Caprolactam degradation
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01120  Microbial metabolism in diverse environments
mid01130  Biosynthesis of antibiotics
mid01212  Fatty acid metabolism
Module
mid_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MIP_07373
   00650 Butanoate metabolism
    MIP_07373
  Lipid metabolism
   00071 Fatty acid degradation
    MIP_07373
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MIP_07373
   00310 Lysine degradation
    MIP_07373
   00360 Phenylalanine metabolism
    MIP_07373
   00380 Tryptophan metabolism
    MIP_07373
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MIP_07373
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MIP_07373
   00281 Geraniol degradation
    MIP_07373
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MIP_07373
   00627 Aminobenzoate degradation
    MIP_07373
   00930 Caprolactam degradation
    MIP_07373
Enzymes [BR:mid01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MIP_07373
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AFS16952
UniProt: J9WQE9
Position
complement(5286477..5287253)
Genome map
AA seq 258 aa AA seqDB search
MSEEANEPEVLVEQRDRILIITINRPKAKNAVNSAVANGLAAAVDRLDDEPGLSVGILTG
AGGSFCAGMDLKAFARGELPIVEGRGMGFTERPPVKPLIAAVEGYALAGGTELALATDLI
VASKDSAFGIPEVKRGLVAGGGGLLRLPQRIPSAIAMELALTGENLSAERAHALGMVNVL
AEPGSALDAAIELAEKIAANGPLAVAATKQIIVESRGWSPETMFAEQNKLLAPVFSSNDA
KEGAIAFAEKRPPKWTGT
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgaagaggccaacgaacccgaagtcctggtcgaacagcgggaccggatcctcatc
atcacgatcaaccggccgaaggccaagaacgcggtcaactccgcggtggccaacggcctg
gccgccgccgtcgaccggctcgacgacgaacccggcctgtcggtcggcatcctcaccggc
gcgggcggctcgttctgcgcgggcatggacctcaaggccttcgcccgcggcgagctcccg
atcgtcgagggccgcggcatgggcttcaccgaacgtccgccggtcaagccgctgatcgcg
gcggtcgagggctacgcgctggccggcggcaccgagctggcgttggcgaccgacctgatc
gtggcctccaaggactcggcgttcggcatcccggaggtcaagcgcggcctggtcgccggg
ggcggcgggctgctgcggctgccgcaacgcatcccgtccgcgatcgccatggagctggca
ctgaccggtgaaaacctgagcgccgagcgcgcgcacgcgctgggaatggtcaacgtcctc
gccgagcccggatcggcgctggacgcggcgatcgagctggccgagaagatcgccgcgaac
gggccgctggcggtggccgccaccaagcagatcatcgtcgagtcccgcggctggagcccc
gagaccatgttcgccgagcagaacaagctgctcgccccggtgttctcctccaacgacgcc
aaggagggcgcgatcgccttcgccgagaagcgcccgcccaagtggacgggcacttaa

DBGET integrated database retrieval system